Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_078211033.1 BXU11_RS03565 ABC transporter ATP-binding protein
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_002017945.1:WP_078211033.1 Length = 233 Score = 153 bits (387), Expect = 3e-42 Identities = 87/236 (36%), Positives = 139/236 (58%), Gaps = 19/236 (8%) Query: 18 VEIVNMNKWY----GDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQKGK 73 +EI +++K Y + HVL+ IN + GE + I G SGSGKST++ + L+E G Sbjct: 2 IEIKDLHKSYKMGSSELHVLKGINFNIKEGELVAIMGSSGSGKSTLLNILGILDEADSGS 61 Query: 74 IVVDGTELTNDLKKIDEV------RREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKK 127 ++D T +KK++E + +G VFQ FNL + T L+N + P++ + + +K Sbjct: 62 YILD----TVPIKKLNETIASKYRNQFLGFVFQSFNLINYKTALDNVAM-PLYYQGIKRK 116 Query: 128 QAEEVAMHFLKRVKIPEQANKYPGQLSGGQQQRVAIARSLCMNPKIMLFDEPTSALDPEM 187 + E+AM +L +V + ++ P +LSGGQ+QRVAIAR+L NPK++L DEPT ALD + Sbjct: 117 ERNEIAMKYLGKVGLATHSHHLPNELSGGQKQRVAIARALASNPKVLLADEPTGALDTKT 176 Query: 188 IKEVLDTMVGLAEEGMTMLCVTHEMGFARQVANRVIFMD----QGQIVEQNEPAAF 239 EV++ + G+ +EG T+L VTHE A V+ D ++VEQ +++ Sbjct: 177 SYEVMELIQGINDEGKTILIVTHEPDIAAMCKRNVVLKDGLIIDDKLVEQVRASSY 232 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 233 Length adjustment: 24 Effective length of query: 233 Effective length of database: 209 Effective search space: 48697 Effective search space used: 48697 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory