Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_024981057.1 BXU11_RS07070 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >NCBI__GCF_002017945.1:WP_024981057.1 Length = 220 Score = 93.2 bits (230), Expect = 4e-24 Identities = 73/235 (31%), Positives = 127/235 (54%), Gaps = 23/235 (9%) Query: 4 LVVKNLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPT 63 ++ KN+ K + ++E +K V + + EIVS+VG SG+GKTT +++ L PT Sbjct: 2 ILAKNIHKFYD-------QLEVLKGVDLHITKGEIVSIVGASGAGKTTLLQILGTLDRPT 54 Query: 64 SGE---IYFEGKDIWKDIKDRESLVEFRR-KVHAVFQDPFASYNP-FYPVERTLWQAISL 118 S E + G+D+ K + ++L FR + +FQ F P F +E A Sbjct: 55 SNENSSLLINGEDVLK--MNDKALSRFRNLNLGFIFQ--FHQLLPEFTALENVCIPAFIA 110 Query: 119 LENKPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVA 178 +NK + EA K+ L +G+ + P+++SGG++QR+ +AR I +P ++ A Sbjct: 111 GKNKLETEIEA----KKLLDYLGLSHRH--HHKPNELSGGEQQRVAVARALINKPDILFA 164 Query: 179 DEPTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEI 233 DEP+ +D +S + +L +LR+E G + + +TH+ LA ++D VM +G+I Sbjct: 165 DEPSGNLDTTSAENLHQLFFKLRDELGQTFVIVTHNEELA-NMADRKLVMVDGQI 218 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 220 Length adjustment: 23 Effective length of query: 245 Effective length of database: 197 Effective search space: 48265 Effective search space used: 48265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory