Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_078212710.1 BXU11_RS12070 phosphate ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_002017945.1:WP_078212710.1 Length = 252 Score = 96.7 bits (239), Expect = 4e-25 Identities = 75/235 (31%), Positives = 125/235 (53%), Gaps = 22/235 (9%) Query: 7 NLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRL--LMPQ---SGTVF- 60 +L++ YG K L+ VS+ + K+TALIGP+GCGKST L C +R+ L+P SG + Sbjct: 10 DLSLFYGEKKALSSVSMQIQANKVTALIGPSGCGKSTFLRCINRMNDLIPGVKISGRMLV 69 Query: 61 ----LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDN 116 + D +++++ R +++ ++ Q P ++ E V+YG P ++ + D Sbjct: 70 EGIDIYDKEVDVVNIR---KKIGMVFQKS-NPFPKSIFENVAYG--PRINGIKNKTQLDE 123 Query: 117 ARVNVAMNQTRINHLAVRRLTE----LSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDIN 172 V V++ Q I RL + LSGGQ+QR +A LA N ++L+DEP + LD Sbjct: 124 I-VEVSLRQAAIWEELKDRLDDSAMGLSGGQQQRLCIARTLAVNPDIILMDEPASALDPL 182 Query: 173 HQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMT 227 + L+ EL+ Q T+V V H++ QA+R D G ++ G +++ T Sbjct: 183 STSKIEELVHELKEQ-YTIVIVTHNMQQAARTSDHTAFFYMGELIEMGKTKDIFT 236 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory