Align 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Gamma-aminobutyraldehyde dehydrogenase; EC 1.2.1.47; EC 1.2.1.3; EC 1.2.1.19 (characterized)
to candidate WP_078212801.1 BXU11_RS12805 aldehyde dehydrogenase
Query= SwissProt::Q9JLJ3 (494 letters) >NCBI__GCF_002017945.1:WP_078212801.1 Length = 442 Score = 144 bits (362), Expect = 8e-39 Identities = 106/348 (30%), Positives = 165/348 (47%), Gaps = 17/348 (4%) Query: 138 SFGYTRREPLGVCLGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYT 197 S Y REP G L I WNYPFQ+A A+A GN ++ KPS TP +A ++ +I Sbjct: 80 STDYILREPYGKVLIIAPWNYPFQLALCPLISAVAAGNQVVIKPSELTPNTAKIIEKIIE 139 Query: 198 KAGAPNGLFNVVQGGAATGQFLCQHRDVAKVSFTGSVPTGMKIMEMAAKGIKPITLELGG 257 + + V GG Q L R + FTGSV G I + AA + P+TLELGG Sbjct: 140 RVFHVAHV-KVENGGIDMAQKLLSER-WDYIFFTGSVAVGKIIAKAAAIHLTPVTLELGG 197 Query: 258 KSPLIIFSDCNMKNAVKGALLANFLTQGQVCCNGTRVFVQKEIADAFTKEVVRQTQRIKI 317 K+P II N+K A K + F+ GQ C + +QK++ F + + + Q+ Sbjct: 198 KNPCIIDETANLKLAAKRIVWGKFINAGQTCIAPDYILIQKDMKSHFVEYLKVELQK-AF 256 Query: 318 GDPLLEDTRMGPLINAPHLERVLGFVRSAKEQGATVLCGGEPYAPEDPKLKHGYYMTPCI 377 GD + ++N + R++ + K VL GGE + Y+ P + Sbjct: 257 GDHPKTSPDLARIVNEKNWLRLVNMIDPKK-----VLLGGETDIED-------CYIAPTL 304 Query: 378 LTNCTDDMTCVKEEIFGPVMSILTFETEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAE 437 + + + +++EIFGP++ +LT++ E+ LA VFT D + + + Sbjct: 305 IEETSLESLVMQDEIFGPLLPMLTYDDPNEIEAIIARYEKPLALYVFTEDHRFGKEIMKK 364 Query: 438 LQAGTCYINN--YNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTV 483 G IN+ + S LPFGG SG G +G+++ + +S K V Sbjct: 365 YSFGGGCINDTVIHFSNQRLPFGGVGHSGIGAYHGKLSFDTFSHKKGV 412 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 442 Length adjustment: 33 Effective length of query: 461 Effective length of database: 409 Effective search space: 188549 Effective search space used: 188549 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory