Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_024981780.1 BXU11_RS13235 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_002017945.1:WP_024981780.1 Length = 248 Score = 109 bits (272), Expect = 6e-29 Identities = 84/256 (32%), Positives = 131/256 (51%), Gaps = 22/256 (8%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANV---YICDVDPAAI--DRARTAHPQLHAGVADV 66 G +I+GA+ GIG IA+ F GAN+ Y V+ A + T + ++ Sbjct: 6 GKVAIITGASRGIGKGIAEVFAKHGANIAFTYSSSVESALALENELNTMGIKAKGYQSNA 65 Query: 67 SDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLR 126 +D + +D + G +D+LINNAGI + + A++++ I NL S F + Sbjct: 66 ADFNEAQTFVDAVLADFGSVDILINNAGIT-KDNLMMRMSEADFDQVIDVNLKSVFN-MT 123 Query: 127 KAVP--LLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRV 184 KA+ LK+ + + II M+SV G G A +T YAASK ++G KS+A+ELG N+R Sbjct: 124 KAIQKTFLKQRAGS--IINMSSVVGVKGNAGQTNYAASKAGVIGFSKSVALELGSRNIRC 181 Query: 185 NAILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASP 244 N I PG +E E + + D +KG + + I L+R + DVA LF AS Sbjct: 182 NVIAPGFIETEMTAK----------LSDDVVKG-WREGIPLKRGGSTDDVANACLFFASD 230 Query: 245 AGQNISGQAISVDGNV 260 ++GQ ++V G + Sbjct: 231 MSAYVTGQVLNVCGGM 246 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory