Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_024981057.1 BXU11_RS07070 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_002017945.1:WP_024981057.1 Length = 220 Score = 109 bits (272), Expect = 5e-29 Identities = 67/220 (30%), Positives = 114/220 (51%), Gaps = 8/220 (3%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMM---TICGSPQARTGS 67 ++ + +Y + L GVD+H+ KGEIVS++GA+GAGK+TL+ T+ S Sbjct: 1 MILAKNIHKFYDQLEVLKGVDLHITKGEIVSIVGASGAGKTTLLQILGTLDRPTSNENSS 60 Query: 68 VVFEGRDITRMPTHEIARLR---IAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVE 124 ++ G D+ +M ++R R + + ++ P T LEN+ + A + ++E Sbjct: 61 LLINGEDVLKMNDKALSRFRNLNLGFIFQFHQLLPEFTALENVCIPAFIAGKNKLETEIE 120 Query: 125 -KIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIF 183 K + L RH + LSGGEQQ +++ RAL+ +P +L DEPS L + + Sbjct: 121 AKKLLDYLGLSHRHHHKPNELSGGEQQRVAVARALINKPDILFADEPSGNLDTTSAENLH 180 Query: 184 EAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVT 223 + KL + G T +V N A ++ R VMV+G+++ Sbjct: 181 QLFFKLRDELGQTFVIVTHNEELA-NMADRKLVMVDGQIS 219 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 220 Length adjustment: 23 Effective length of query: 224 Effective length of database: 197 Effective search space: 44128 Effective search space used: 44128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory