Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_024982395.1 BXU11_RS05265 LPS export ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_002017945.1:WP_024982395.1 Length = 250 Score = 116 bits (290), Expect = 5e-31 Identities = 70/230 (30%), Positives = 120/230 (52%), Gaps = 5/230 (2%) Query: 15 NGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVFEGRD 74 N ++TY G + G+ + VN+GEIV L+G NGAGK+T I G + +G + + D Sbjct: 7 NLIKTYKGR-SVVKGISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNSGHIYLDDLD 65 Query: 75 ITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLFPRLK 134 IT+ P ++ A+ + + +F ++++ +N+ L N E V K+ +L Sbjct: 66 ITQYPMYKRAQQGVGYLAQEASVFRKLSIEDNILSVLQLTNHTK-EEQVAKMESLIAEFS 124 Query: 135 ERH--AQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLNEA 192 H RG LSGGE++ I R L PK +LLDEP G+ P+ V+ I + +L Sbjct: 125 LEHIRTNRGDLLSGGERRRTEIARCLATDPKFILLDEPFAGVDPVAVEDIQRIVAQLKN- 183 Query: 193 EGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 + + + + + N L ++ + Y+M G + +G+ +EL+ + VR YL Sbjct: 184 KNIGILITDHNVQETLAITDKTYLMFEGGILKAGTPEELVEDEMVRRVYL 233 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 250 Length adjustment: 24 Effective length of query: 223 Effective length of database: 226 Effective search space: 50398 Effective search space used: 50398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory