Align proton/sodium-glutamate symport protein GltT (characterized)
to candidate WP_024981841.1 BXU11_RS13550 cation:dicarboxylase symporter family transporter
Query= CharProtDB::CH_088342 (421 letters) >NCBI__GCF_002017945.1:WP_024981841.1 Length = 417 Score = 298 bits (764), Expect = 2e-85 Identities = 161/408 (39%), Positives = 247/408 (60%), Gaps = 16/408 (3%) Query: 5 GLAWQIFIGLILGIIVGAIFYGN------PKVAAYLQPIGDIFLRLIKMIVIPIVISSLV 58 GL QI I +ILG I+G + + + + ++ + IF+RL++MI+ P+V ++LV Sbjct: 14 GLTGQILIAMILGAILGIFIHTSWEPEHAQEFSNKIKILATIFIRLVQMIISPLVFTTLV 73 Query: 59 VGVASVGDLKKLGKLGGKTIIYFEIITTIAIVVGLLAANIFQPGAGVNMKSLEKTDIQSY 118 VG+A +GD+K +G++GGK + +F + I++++G+ NI PG G+N+ ++ D + Sbjct: 74 VGIAKLGDVKAVGRIGGKALAWFFTASFISLLIGMFYVNILTPGIGLNLSNI---DASTA 130 Query: 119 VDTTNEVQHHSMVETFVNIVPKNIFESLSTGDMLPIIFFSVMFGLGVAAIGEKGKPVLQF 178 + T + Q S +IVPK+I E+++T ++L I+ FS+ FGL A+IG KP++ F Sbjct: 131 TEVTGKAQSLSFNNFIEHIVPKSIIEAMATNEILQIVVFSIFFGLAAASIGNHAKPIVDF 190 Query: 179 FQGTAEAMFYVTNQIMKFAPFGVFALIGVTVSKFGVESLIPLSKLVIVVYATMLFFI--- 235 + + + N +MKFAP GVF G F V L+ + + L I Sbjct: 191 MDRLSHIILKMVNFVMKFAPVGVF---GAIAGVFAVRDFSELAFTYFKFFGSFLVGIATL 247 Query: 236 FAVLGGVAKLF-GINIFHIIKILKDELILAYSTASSETVLPRIMDKMEKFGCPKAITSFV 294 + +L + LF G + ++ + LI+A+ T SSE V P++ +++E+FG I SF+ Sbjct: 248 WLILIAIGYLFLGKRMKTLLNHIISPLIIAFGTTSSEAVFPKLTEELERFGVKDKIVSFM 307 Query: 295 IPTGYSFNLDGSTLYQALAAIFIAQLYGIDMSVSQQISLLLVLMVTSKGIAGVPGVSFVV 354 +P GYSFNLDGS +Y A IFIAQ YGID+ + Q ++LLVLM+TSKGIAGVP S VV Sbjct: 308 LPLGYSFNLDGSMMYMTFAGIFIAQAYGIDLDLPTQFTMLLVLMLTSKGIAGVPRASLVV 367 Query: 355 LLATLGTVGIPVEGLAFIAGIDRILDMARTAVNVIGNSLAAIIMSKWE 402 + AT G IPVEG+A I ID DM R+A NV+GN+LA ++ KWE Sbjct: 368 VAATCGMFDIPVEGIALILPIDHFCDMFRSATNVLGNALATSVVGKWE 415 Lambda K H 0.326 0.143 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 417 Length adjustment: 32 Effective length of query: 389 Effective length of database: 385 Effective search space: 149765 Effective search space used: 149765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory