Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_078211525.1 BXU11_RS06925 acetyl-CoA C-acyltransferase
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_002017945.1:WP_078211525.1 Length = 393 Score = 387 bits (993), Expect = e-112 Identities = 205/392 (52%), Positives = 264/392 (67%), Gaps = 2/392 (0%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 MK A IV RT VGKA KG RPD+L A ++ + ++ IDD+++G A P Sbjct: 1 MKTAYIVKAYRTAVGKAPKGVFRFKRPDELAAETIQYMMNELPDFDKTRIDDVMVGNAMP 60 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 EAEQGLN+ R I + VP +TVNRYC+SGL++I A KI G IAGGAES Sbjct: 61 EAEQGLNVGRLISLMGLKVDDVPGVTVNRYCASGLETIGMATAKIQSGMAHCIIAGGAES 120 Query: 120 MSQVPMMGHVTRPNLALAEKAPE-YYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAK 178 MS +PM G+ P+ +A E YY MG T+E VAK++ +SR DQD FA +SH A K Sbjct: 121 MSYIPMGGYKPTPDYKVAAAGHEDYYWGMGLTSEAVAKQFNISRADQDEFAFQSHNKALK 180 Query: 179 ALAEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDG 238 A AEGKF ++IVP+ V T I E+ K K +V ++DEG R T+ + L+ LRP F+ DG Sbjct: 181 AQAEGKFDNQIVPITVEQTFINENGKKETKSYVVTKDEGPRAGTSLEALAGLRPVFAADG 240 Query: 239 TVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRA 298 +VTAGNSSQ SDGAA V++M E L + P+ + +FA GV P +MGIGPV+AIP+A Sbjct: 241 SVTAGNSSQMSDGAAFVLVMSEEMVKELNIQPIARLVNFASAGVEPRIMGIGPVKAIPKA 300 Query: 299 LKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTL 358 LK AGL L DI L ELNEAFASQA+ V REL ++ + +NVNGGAIALGHPLGCTG KL++ Sbjct: 301 LKQAGLTLNDIDLIELNEAFASQALAVTRELNLNPDIINVNGGAIALGHPLGCTGAKLSV 360 Query: 359 SLIHEMKRRNEQFGVVTMCIGGGMGAAGVFEL 390 L EMKRR ++G+V+MC+G G G+AG+FEL Sbjct: 361 QLFDEMKRRGNKYGIVSMCVGTGQGSAGIFEL 392 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 393 Length adjustment: 31 Effective length of query: 360 Effective length of database: 362 Effective search space: 130320 Effective search space used: 130320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_078211525.1 BXU11_RS06925 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.2433198.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-139 448.5 1.0 1.1e-138 448.3 1.0 1.0 1 NCBI__GCF_002017945.1:WP_078211525.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002017945.1:WP_078211525.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.3 1.0 1.1e-138 1.1e-138 1 385 [] 6 391 .. 6 391 .. 0.97 Alignments for each domain: == domain 1 score: 448.3 bits; conditional E-value: 1.1e-138 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaalaagl 70 iv+a+Rt++g + +g+++ ++++L+a++i+ +++ ++d+ +id+v++Gn+++++eq n++R + l NCBI__GCF_002017945.1:WP_078211525.1 6 IVKAYRTAVGkAPKGVFRFKRPDELAAETIQYMMNELpDFDKTRIDDVMVGNAMPEAEQgLNVGRLISLMGLK 78 89********988******************************************************998777 PP TIGR01930 71 pesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkd 143 ++vp++tvnr+CaSgl+++ +a +ki++G+a +++aGG+EsmS +p++ + + ++k+ +a ed NCBI__GCF_002017945.1:WP_078211525.1 79 VDDVPGVTVNRYCASGLETIGMATAKIQSGMAHCIIAGGAESMSYIPMGGYKP--TPDYKVAAAGHED----- 144 789**********************************************9998..7899988888887..... PP TIGR01930 144 lvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk...........kkvv 205 mg t+e +ak+++isR +qDe+a +Sh+ka kA++egkf+++ivp++v+++ + vv NCBI__GCF_002017945.1:WP_078211525.1 145 ---YYWGMGLTSEAVAKQFNISRADQDEFAFQSHNKALKAQAEGKFDNQIVPITVEQTfinengkketkSYVV 214 ...4699*************************************************99*******99988899 PP TIGR01930 206 skDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvd 278 +kDeg+r++t+le+La+L+p+f+ +gs vtAgNssq++DGAa++l+msee++kel+++p+ar+v++a agv+ NCBI__GCF_002017945.1:WP_078211525.1 215 TKDEGPRAGTSLEALAGLRPVFAA-DGS-VTAGNSSQMSDGAAFVLVMSEEMVKELNIQPIARLVNFASAGVE 285 **********************95.9*7.******************************************** PP TIGR01930 279 peemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGar 351 p++mg+gpv+Ai+kaLk+agl+++didl+E+nEAFA+q+lav++el+ l+++ +NvnGGAiAlGHPlG++Ga NCBI__GCF_002017945.1:WP_078211525.1 286 PRIMGIGPVKAIPKALKQAGLTLNDIDLIELNEAFASQALAVTRELN-LNPDIINVNGGAIALGHPLGCTGAK 357 ***********************************************.88*********************** PP TIGR01930 352 ivltllkeLkergkkyGlatlCvggGqGaAvile 385 + ++l++e+k+rg kyG++++Cvg+GqG+A i+e NCBI__GCF_002017945.1:WP_078211525.1 358 LSVQLFDEMKRRGNKYGIVSMCVGTGQGSAGIFE 391 *******************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 18.26 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory