Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_024981186.1 BXU11_RS06395 3-ketoacyl-ACP reductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_002017945.1:WP_024981186.1 Length = 238 Score = 93.6 bits (231), Expect = 3e-24 Identities = 66/201 (32%), Positives = 105/201 (52%), Gaps = 14/201 (6%) Query: 2 DLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSSTEVQGYAL- 60 DLK+K +ITG G+G A+A A+ G + L+ Q +++ ++ S+ V+ AL Sbjct: 3 DLKNKNALITGAGKGIGKAIAIALAKEGVNVVLMARTQTEIDEVAKEI-SAFGVKSLALT 61 Query: 61 -DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 D+ D V L F I++L+NNAGI G ++ + +++ +I Sbjct: 62 ADVADMHSVNLAVEKALSTFKTIDILINNAGIAAFGKFLELEPS---------EWERIIQ 112 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLAKA-GNVGQSNYAASKAGVAAMSVGWAK 178 VNL G + R MIE Q G I+NISS A GN S Y+ASK G+ ++ + Sbjct: 113 VNLMGVYYVTRAILPNMIER-QTGDIINISSTAGLNGNALTSAYSASKFGLLGLTDSLMQ 171 Query: 179 ELARYNIRSAAVAPGVIATEM 199 E+ ++NIR +A+ P +AT+M Sbjct: 172 EMRKHNIRVSALTPSTVATDM 192 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 238 Length adjustment: 24 Effective length of query: 228 Effective length of database: 214 Effective search space: 48792 Effective search space used: 48792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory