Align 6-phosphofructokinase (EC 2.7.1.11) (characterized)
to candidate WP_078210593.1 BXU11_RS00305 1-phosphofructokinase family hexose kinase
Query= BRENDA::P06999 (309 letters) >NCBI__GCF_002017945.1:WP_078210593.1 Length = 310 Score = 224 bits (572), Expect = 2e-63 Identities = 126/304 (41%), Positives = 188/304 (61%), Gaps = 2/304 (0%) Query: 4 IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGG 63 I TLT+ P++D +T + E K+RC P ++ GGGGINV++AIA LGG++ A+F +GG Sbjct: 6 IVTLTVNPAVDKSTSFKGLVAEQKIRCEVPRYDAGGGGINVSKAIARLGGNSMALFTSGG 65 Query: 64 ATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEE 123 A G+ L L+A EN+ V + WTR++ + QYRF G A+ +E Sbjct: 66 AMGQLLEELVAKENIASEAVAVESWTRESFVAVDTNTNSQYRFGFTGGAITPEESECFLA 125 Query: 124 QVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIEL 183 ++ E + LV SGSL G+ + ++ A+ G + IVD+SG AL L +G L Sbjct: 126 KIAEFKP-KFLVGSGSLNEGLNADFYQKVAQIAKANGSKLIVDTSGAALEKVLEVGAY-L 183 Query: 184 VKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVP 243 +KPN EL+ L+ E + ++V +AA++I+ G A+ VVVSLGPQGA+ V ++ V Sbjct: 184 IKPNVGELAKLIGEERLEMEEVNEAAKKIIAKGGAEIVVVSLGPQGAVLVTKDHYEFVPA 243 Query: 244 PPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDTQKI 303 P V +STVGAGDSMVG M L++N L+E++R+GVA GSAAT+N+GT+L D Q++ Sbjct: 244 PNVAKKSTVGAGDSMVGGMVWALSQNKPLKEVIRWGVACGSAATMNEGTQLFKGSDAQRL 303 Query: 304 YAYL 307 + +L Sbjct: 304 FDWL 307 Lambda K H 0.314 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 310 Length adjustment: 27 Effective length of query: 282 Effective length of database: 283 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory