Align LacK, component of Lactose porter (characterized)
to candidate WP_024982365.1 BXU11_RS06035 ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_002017945.1:WP_024982365.1 Length = 314 Score = 117 bits (292), Expect = 5e-31 Identities = 68/236 (28%), Positives = 124/236 (52%), Gaps = 6/236 (2%) Query: 4 VRLTDIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGELTIG 63 + + +I +Y +I+ V+ V G+ + +G SGCGKSTLL++I G+ D+ G++ Sbjct: 2 LEVQNISFAYTDKAIIQNVDFTVEKGQNIALIGESGCGKSTLLKLIYGIYDLHEGKIFFN 61 Query: 64 GTVM----NDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119 T + ++ P + + Q + L P TV EN+G L M ++ R+ + Sbjct: 62 QTRVLGPKYNLVPGMPFMKYLAQDFDLMPFETVAENVGKFLSNGFMPLKKL--RIQELLE 119 Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179 ++E+ + K LSGGQ+QRVA+ + + +P V L DEP S++D + +R + Sbjct: 120 MVEMTDYAKVRAKDLSGGQQQRVALAKVLAVEPQVLLLDEPFSHIDNFRKNALRRNLFAY 179 Query: 180 HKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIG 235 K+ T + THD +A++ +D+ +V++ G + + + +Y P N +VA G Sbjct: 180 LKKKGITCIIATHDSTDALSFSDETIVLQQGRIVEKAPSVEVYQFPINKYVASLFG 235 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 314 Length adjustment: 28 Effective length of query: 335 Effective length of database: 286 Effective search space: 95810 Effective search space used: 95810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory