Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate WP_024981057.1 BXU11_RS07070 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >NCBI__GCF_002017945.1:WP_024981057.1 Length = 220 Score = 122 bits (306), Expect = 9e-33 Identities = 69/215 (32%), Positives = 115/215 (53%), Gaps = 10/215 (4%) Query: 7 KNLQKGFEGFSIIKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAG---TIELD 63 KN+ K ++ ++KG+DL + E V VG SG GK+TLL+++ L+ T+ ++ ++ Sbjct: 5 KNIHKFYDQLEVLKGVDLHITKGEIVSIVGASGAGKTTLLQILGTLDRPTSNENSSLLIN 64 Query: 64 GRDITEVSPA------KRDLAMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVEKKVNEA 117 G D+ +++ +L +FQ + L P + +N+ +AG NK E E + + Sbjct: 65 GEDVLKMNDKALSRFRNLNLGFIFQFHQLLPEFTALENVCIPAFIAGKNKLETEIEAKKL 124 Query: 118 ARILELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELA 177 L L KP +LSGG++QRVA+ RA++ P I DEP NLD + Sbjct: 125 LDYLGLSHRHHHKPNELSGGEQQRVAVARALINKPDILFADEPSGNLDTTSAENLHQLFF 184 Query: 178 RLHKELQATMIYVTHDQVEAMTLADKVVVLNGGRI 212 +L EL T + VTH++ E +AD+ +V+ G+I Sbjct: 185 KLRDELGQTFVIVTHNE-ELANMADRKLVMVDGQI 218 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 220 Length adjustment: 26 Effective length of query: 341 Effective length of database: 194 Effective search space: 66154 Effective search space used: 66154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory