Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_024982395.1 BXU11_RS05265 LPS export ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_002017945.1:WP_024982395.1 Length = 250 Score = 127 bits (318), Expect = 3e-34 Identities = 69/215 (32%), Positives = 118/215 (54%), Gaps = 3/215 (1%) Query: 24 VSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDDKDITDWQTAKIMREAVA 83 +SL +NQGEIV L+G NGAGKTT + G + SG I DD DIT + K ++ V Sbjct: 21 ISLEVNQGEIVGLLGPNGAGKTTSFYMIVGLVKPNSGHIYLDDLDITQYPMYKRAQQGVG 80 Query: 84 IVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELFPR--LHERRIQRAGTMSGG 141 + + VF ++++E+N+ + +E++ + L L R R +SGG Sbjct: 81 YLAQEASVFRKLSIEDNI-LSVLQLTNHTKEEQVAKMESLIAEFSLEHIRTNRGDLLSGG 139 Query: 142 EQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTIFLVEQNANQAL 201 E++ I R L ++P+ +LLDEP G+ P+ ++ I + QL+ + + I + + N + L Sbjct: 140 ERRRTEIARCLATDPKFILLDEPFAGVDPVAVEDIQRIVAQLKNKNIGILITDHNVQETL 199 Query: 202 KLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 + D+ Y++ G ++ + T + L+ +E VR YLG Sbjct: 200 AITDKTYLMFEGGILKAGTPEELVEDEMVRRVYLG 234 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 106 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 250 Length adjustment: 23 Effective length of query: 214 Effective length of database: 227 Effective search space: 48578 Effective search space used: 48578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory