Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_024981091.1 BXU11_RS06900 ATP-binding cassette domain-containing protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_002017945.1:WP_024981091.1 Length = 297 Score = 109 bits (273), Expect = 5e-29 Identities = 68/219 (31%), Positives = 116/219 (52%), Gaps = 8/219 (3%) Query: 7 KVLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNI 66 + +L + L YG IQA+K V FE+++G + ++G NG+GK+TT+ ++ + GN Sbjct: 2 ETILSINNLNKRYGKIQALKNVSFEIKKGNVYGILGPNGSGKSTTLGITLNVVNASSGNY 61 Query: 67 EYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMF 126 ++ + + A L K G ++ E + MT ENL++ I+ + IE+ Sbjct: 62 QWFDGTTETHEA--LKKVGAII--ERPNFYPYMTAHENLKLVCKIKNIN---YSKIEEKL 114 Query: 127 TIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVR 186 + L ERKD T S G +Q LA+ AL++ P++L+LDEP+ GL P + +I ++++ Sbjct: 115 ELVG-LIERKDSKFSTFSLGMKQRLAIASALLNDPEILILDEPTNGLDPQGIHQIRDIIK 173 Query: 187 DVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGP 225 + ALG TI+L + V++ G I GP Sbjct: 174 KIAALGTTILLASHLLDEVEKVCSHVVVLQKGEILYAGP 212 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 297 Length adjustment: 25 Effective length of query: 217 Effective length of database: 272 Effective search space: 59024 Effective search space used: 59024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory