Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_024981186.1 BXU11_RS06395 3-ketoacyl-ACP reductase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_002017945.1:WP_024981186.1 Length = 238 Score = 113 bits (283), Expect = 3e-30 Identities = 69/191 (36%), Positives = 101/191 (52%), Gaps = 8/191 (4%) Query: 1 MKRLSGKRALITGAARGIGAAFAEAYANEGARVVI-----ADIDTARAEATAAQIGAAAI 55 M L K ALITGA +GIG A A A A EG VV+ +ID E +A G ++ Sbjct: 1 MTDLKNKNALITGAGKGIGKAIAIALAKEGVNVVLMARTQTEIDEVAKEISA--FGVKSL 58 Query: 56 AVELDVTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGT 115 A+ DV D S++ A+ + + F +DILINNA + +E+ ++R +N+ G Sbjct: 59 ALTADVADMHSVNLAVEKALSTFKTIDILINNAGIAAFGKFLELEPSEWERIIQVNLMGV 118 Query: 116 LFMMQAAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHG 175 ++ +A MI + T G IIN++S AG G L S Y A+K ++ LT S + H Sbjct: 119 YYVTRAILPNMIERQT-GDIINISSTAGLNGNALTSAYSASKFGLLGLTDSLMQEMRKHN 177 Query: 176 INVNAIAPGVV 186 I V+A+ P V Sbjct: 178 IRVSALTPSTV 188 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 238 Length adjustment: 24 Effective length of query: 233 Effective length of database: 214 Effective search space: 49862 Effective search space used: 49862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory