Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_078210695.1 BXU11_RS01105 SDR family NAD(P)-dependent oxidoreductase
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_002017945.1:WP_078210695.1 Length = 250 Score = 87.0 bits (214), Expect = 3e-22 Identities = 69/192 (35%), Positives = 101/192 (52%), Gaps = 18/192 (9%) Query: 10 KTVIVTGASSGIGKAIVDELLSLKVKVA----NFDLTDNGEKHENLLFQKV-----DVTS 60 KT ++TGA+SGIGKA L K+ D + EK E F V DV Sbjct: 3 KTALITGATSGIGKATATLLAQNNFKIVLCGRRKDRLEALEK-ELSAFTAVHTLCFDVRD 61 Query: 61 REQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQKG 120 ++ V S+A++ E F +D +VNNAG N L D ++DD ++ + IN KG Sbjct: 62 KKAVFESIASLPEAFSDIDILVNNAG-NAHGL-----DSIQNGDMDD--WDAMIDINVKG 113 Query: 121 LYLVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGKYG 180 L +S+A+ ++AK+ G IIN+ S AG E + Y +K AV + +S +L YG Sbjct: 114 LLYISKAIIPKMIAKESGHIINIGSIAGKEVYPNGNVYCASKYAVDALNQSMRMDLNPYG 173 Query: 181 VRVVGIAPGIME 192 +RV GI PG++E Sbjct: 174 IRVGGIHPGMVE 185 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 250 Length adjustment: 24 Effective length of query: 242 Effective length of database: 226 Effective search space: 54692 Effective search space used: 54692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory