Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_078211525.1 BXU11_RS06925 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_002017945.1:WP_078211525.1 Length = 393 Score = 276 bits (705), Expect = 1e-78 Identities = 172/410 (41%), Positives = 233/410 (56%), Gaps = 26/410 (6%) Query: 1 MNEALIIDAVRTPIGRYA-GALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQ 59 M A I+ A RT +G+ G R D+L A ++ ++ P D + +DDV+ G A Sbjct: 1 MKTAYIVKAYRTAVGKAPKGVFRFKRPDELAAETIQYMMNELPDFDKTRIDDVMVGNAMP 60 Query: 60 AGEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVES 119 E NV R+ +L+ VPG T+NR C SGL+ +G A ++ G A ++AGG ES Sbjct: 61 EAEQGLNVGRLISLMGLKVDDVPGVTVNRYCASGLETIGMATAKIQSGMAHCIIAGGAES 120 Query: 120 MSRAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRA 179 MS P K + +A + W G G+ T+E VA QFNISRA Sbjct: 121 MSYIPMGGYKPTPDYKVAAAGHEDYY-W---------GMGL-----TSEAVAKQFNISRA 165 Query: 180 DQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQ--------RKGPAKIVEHDEHPRGDTT 231 DQD FA +S +KA A A G+ +IV + + Q ++ + +V DE PR T+ Sbjct: 166 DQDEFAFQSHNKALKAQAEGKFDNQIVPITVEQTFINENGKKETKSYVVTKDEGPRAGTS 225 Query: 232 LEQLAKLGTPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVE 291 LE LA L F GSVTAGN+S ++DGA +L+ S E + ++ AR+V A+AGVE Sbjct: 226 LEALAGLRPVFAADGSVTAGNSSQMSDGAAFVLVMSEEMVKELNIQPIARLVNFASAGVE 285 Query: 292 PRIMGIGPVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGG 351 PRIMGIGPV A K L+ GL L D+D+IELNEAFA+Q LAV REL L D +N NGG Sbjct: 286 PRIMGIGPVKAIPKALKQAGLTLNDIDLIELNEAFASQALAVTRELNLNPD--IINVNGG 343 Query: 352 AIALGHPLGMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401 AIALGHPLG +GA+L E++ R +Y + +MC+G GQG A I E + Sbjct: 344 AIALGHPLGCTGAKLSVQLFDEMKRRGNKYGIVSMCVGTGQGSAGIFELV 393 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 393 Length adjustment: 31 Effective length of query: 370 Effective length of database: 362 Effective search space: 133940 Effective search space used: 133940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory