Protein WP_084931296.1 in Pantoea rwandensis LMG 26275
Annotation: NCBI__GCF_002095475.1:WP_084931296.1
Length: 483 amino acids
Source: GCF_002095475.1 in NCBI
Candidate for 23 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| myo-inositol catabolism | iolT | hi | Major myo-inositol transporter IolT (characterized) | 52% | 95% | 458.4 | Probable metabolite transport protein CsbC | 40% | 365.9 |
| D-cellobiose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-glucose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| lactose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-maltose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| sucrose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| trehalose catabolism | MFS-glucose | med | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 46% | 90% | 377.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-xylose catabolism | xylT | lo | D-xylose transporter; D-xylose-proton symporter (characterized) | 39% | 95% | 325.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| L-arabinose catabolism | araE | lo | Arabinose-proton symporter; Arabinose transporter (characterized) | 36% | 98% | 300.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-galactose catabolism | galP | lo | Arabinose-proton symporter; Arabinose transporter (characterized) | 36% | 98% | 300.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-fructose catabolism | glcP | lo | Glucose/fructose:H+ symporter, GlcP (characterized) | 36% | 100% | 272.3 | Major myo-inositol transporter IolT | 52% | 458.4 |
| sucrose catabolism | glcP | lo | Glucose/fructose:H+ symporter, GlcP (characterized) | 36% | 100% | 272.3 | Major myo-inositol transporter IolT | 52% | 458.4 |
| xylitol catabolism | PLT5 | lo | Polyol (xylitol):H+ symporter, PLT4 (characterized) | 33% | 91% | 254.6 | Major myo-inositol transporter IolT | 52% | 458.4 |
| glycerol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 34% | 89% | 253.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-mannitol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 34% | 89% | 253.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-ribose catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 34% | 89% | 253.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-sorbitol (glucitol) catabolism | SOT | lo | polyol transporter 5 (characterized) | 34% | 89% | 253.4 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-fructose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 35% | 90% | 251.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| sucrose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 35% | 90% | 251.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| myo-inositol catabolism | HMIT | lo | Probable inositol transporter 2 (characterized) | 37% | 60% | 247.7 | Major myo-inositol transporter IolT | 52% | 458.4 |
| D-fructose catabolism | frt1 | lo | Fructose:H+ symporter, Frt1 (characterized) | 31% | 80% | 209.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| sucrose catabolism | frt1 | lo | Fructose:H+ symporter, Frt1 (characterized) | 31% | 80% | 209.9 | Major myo-inositol transporter IolT | 52% | 458.4 |
| trehalose catabolism | TRET1 | lo | Facilitated trehalose transporter Tret1-2 homolog; DmTret1-2 (characterized) | 31% | 90% | 191 | Major myo-inositol transporter IolT | 52% | 458.4 |
Sequence Analysis Tools
View WP_084931296.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MEKELYISTNTASGPNSVTRTEPFVKIIALVATLGGLLFGYDTGVVSGALLFMRDDLQLT
PFTTGLVTSSLLFGAAFGALLAGHFADAMGRRKIIIMLAFIFALGAVGSAFAPDVVSMIV
SRLFLGIAVGGAAATVPVYIAEIAPANKRGQLVTLQELMIVSGQLLAYVSNATFNEIWGG
EHTWRWMLAISTVPAVLLWLGMIFMPESPRWHVMRGNTGEARKVLEKTRAADDVEWELEE
IEETIEENRQKGKGRLRDLKTPWLRKVFLLGIGIAAIQQLTGVNTIMYYAPTMLTATGLS
NDAALFATIANGVISVLMTLVGIWMIGKIGRRPLVLVGQMGCTACLFFIAAVCFFMPEYH
VGGEVNLVRAYLVLTGMLMFLCFQQGALSPVTWLLLSEIFPARLRGICMGGAVFALWMAN
FAISMAFPILLAAFGLAGAFLAFAIIGIGGSMFVLRTIPETRGRSLEQIEHYFYELYDGK
PSR
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory