GapMind for catabolism of small carbon sources

 

Protein WP_084935582.1 in Pantoea rwandensis LMG 26275

Annotation: NCBI__GCF_002095475.1:WP_084935582.1

Length: 304 amino acids

Source: GCF_002095475.1 in NCBI

Candidate for 18 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism AZOBR_RS08235 hi L-proline and D-alanine ABC transporter, permease component 1 (characterized) 56% 99% 340.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 56% 329.7
L-proline catabolism AZOBR_RS08235 hi L-proline and D-alanine ABC transporter, permease component 1 (characterized) 56% 99% 340.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 56% 329.7
L-isoleucine catabolism livH med Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale) 56% 98% 331.3 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-phenylalanine catabolism livH med Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale) 56% 98% 331.3 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-leucine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 56% 98% 329.7 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-valine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 56% 98% 329.7 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-alanine catabolism braD med High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 56% 98% 328.6 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-serine catabolism braD med High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 56% 98% 328.6 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-threonine catabolism braD med High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 56% 98% 328.6 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-arginine catabolism braD med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 49% 99% 303.1 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-glutamate catabolism braD med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 49% 99% 303.1 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-histidine catabolism braD med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 49% 99% 303.1 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-proline catabolism HSERO_RS00885 med ABC transporter permease (characterized, see rationale) 46% 98% 257.7 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-serine catabolism Ac3H11_1695 med ABC transporter permease (characterized, see rationale) 46% 98% 257.7 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-tyrosine catabolism Ac3H11_1695 med ABC transporter permease (characterized, see rationale) 46% 98% 257.7 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-histidine catabolism natD lo NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 97% 132.5 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-leucine catabolism natD lo NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 97% 132.5 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5
L-proline catabolism natD lo NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 97% 132.5 L-proline and D-alanine ABC transporter, permease component 1 56% 340.5

Sequence Analysis Tools

View WP_084935582.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDAFFIQQMINGLTLGAVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLCAIGLALLSY
FGIHSFPLLIFGTLLFTIIVTAAYGWAIERIAYRPLRNSTRLAPLISAIGMSLILQNYVQ
LSQGPNQQGIPTLMTGVLRMEIDGGIVQITWTKVFILIAAFCGMAFLTWIIQYTKLGRIC
RAVQQDRRMASILGINTDRVISLVFVMGAAMAGLAGVLVTMNYGTFDFYAGFIIGIKAFT
AAVLGGIGSLPGAMLGGLLLGVAEAQFAGLVNSDYKDVFSFALLVVILIFRPQGLLGRPL
VAKV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory