Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate WP_084934605.1 HA51_RS11290 NADH-quinone oxidoreductase subunit NuoE
Query= uniprot:Q39TW4 (150 letters) >NCBI__GCF_002095475.1:WP_084934605.1 Length = 171 Score = 92.0 bits (227), Expect = 4e-24 Identities = 47/139 (33%), Positives = 74/139 (53%), Gaps = 4/139 (2%) Query: 11 DKH---DGEASSLIQILLDIQSEHNWLPKEALKRVCERLQVPMSRITHIATFYKAFSLVP 67 +KH D A+S I+ L +Q + W+P A+ + E L +P S + +ATFY P Sbjct: 30 EKHHYEDARAAS-IEALKIVQKQRGWVPDGAINAIAEVLGIPASDVEGVATFYSQIYRTP 88 Query: 68 KGRHQVHVCMGTACHVRGAQRVLDTVQEVTGVKSGETDSDLKFSVETVNCLGCCALGPVM 127 GRH + C CH+ G Q + +++ +K G+T +D +F++ CLG C GP M Sbjct: 89 VGRHVIRYCDSVVCHITGFQGIQAALEQNLNIKPGQTTTDGRFTLLPTCCLGNCDKGPTM 148 Query: 128 EVDGKHHGNIAPSQIASVL 146 VD H ++ P IA++L Sbjct: 149 MVDEDTHVHLTPEGIANLL 167 Lambda K H 0.321 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 90 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 171 Length adjustment: 17 Effective length of query: 133 Effective length of database: 154 Effective search space: 20482 Effective search space used: 20482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory