Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_139810645.1 HA51_RS04965 enoyl-CoA hydratase/isomerase family protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_002095475.1:WP_139810645.1 Length = 257 Score = 132 bits (333), Expect = 5e-36 Identities = 87/253 (34%), Positives = 128/253 (50%), Gaps = 13/253 (5%) Query: 11 EQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSR-KAFAAGADIKE 69 E +I L RPE LNA+ + + A + E RAV+LT + KAF G+DIKE Sbjct: 10 EGNTAIIALNRPEKLNAVTPAMSVSITKLAAFCNESPEVRAVILTANGPKAFCCGSDIKE 69 Query: 70 MAERDLVGILEDP-----RVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIAGED 124 + + P + H IA +KP I A+NG+ LGGG ELA+ DI ++ + Sbjct: 70 L------DTYQSPWAHRMKHDHCDAIAEITKPTICAINGYALGGGLELALCCDIRVSTRN 123 Query: 125 ARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEV-TLPE 183 A FG PEI LG + G G L + +G S A +M+ +G +D+ G+V E+ + Sbjct: 124 ALFGAPEIKLGWVGGGGMAVYLNKTIGASRASRMLYTGDPVDSSTGHAWGIVDELFDTAD 183 Query: 184 LTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEGI 243 ++ +A IA + P+A + AK + A + L +R+ER T+ T D EG Sbjct: 184 DMMDSVKTLAATIASRPPIAAQTAKLNMRAAVNMPLDQAVRYERDLRTICFYTDDAREGK 243 Query: 244 RAFQEKRRPEFTG 256 AF+EKR F G Sbjct: 244 AAFKEKRPANFRG 256 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 257 Length adjustment: 24 Effective length of query: 233 Effective length of database: 233 Effective search space: 54289 Effective search space used: 54289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory