Align ABC transporter for D-Alanine, periplasmic substrate-binding component (characterized)
to candidate WP_084938021.1 HA51_RS24860 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5402 (343 letters) >NCBI__GCF_002095475.1:WP_084938021.1 Length = 341 Score = 470 bits (1209), Expect = e-137 Identities = 227/342 (66%), Positives = 278/342 (81%), Gaps = 3/342 (0%) Query: 2 KLLKSTLAVMTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVGI 61 K++ STL + AA++L V+ A AG TLDA++KKGFVQCG+SDGLPGFS D++GK GI Sbjct: 3 KMMLSTL--VAAASLLAVAQQAHAGTTLDAIKKKGFVQCGISDGLPGFSYADASGKFTGI 60 Query: 62 DADFCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKFP 121 D D CRA AAAVFGDA+KVK++ L AKERFTALQSGE+D+LSRN+T TSSRD GMG F Sbjct: 61 DVDVCRAAAAAVFGDASKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDGGMGFLFA 120 Query: 122 GFITYYDGIGFLANNKLGVKSAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDT 181 G + YYDGIGFL + K G+KSAKELDGAT+CIQAGT TELNV+DYF+AN ++YTP+TFD Sbjct: 121 G-VNYYDGIGFLTHKKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDR 179 Query: 182 SDESAKSLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEWL 241 SDESAK+L+SGRCD L+SD+SQL+A R KL P D++VLPE ISKEPLGPVVR GDD+W Sbjct: 180 SDESAKALDSGRCDTLSSDQSQLYALRVKLGKPDDFIVLPEVISKEPLGPVVRRGDDDWF 239 Query: 242 AIVRWTGYALLNAEEAGVTSKNVEAEAKSTKNPDVARMLGADGEYGKDLKLPKDWVVQIV 301 IV+W+ +A+LNAEE G+ SKNV+ A PD+A +LGA+G++GKDLKL W I+ Sbjct: 240 TIVKWSLFAMLNAEEMGINSKNVDQMAAKPTTPDMAHLLGAEGDFGKDLKLDNKWAYNII 299 Query: 302 KQVGNYGEMFERNLGKGTPLEIDRGLNALWNAGGIQYAPPVR 343 KQVGNY E+F+RN+GK + L+I RG NALWN GGIQYAPPVR Sbjct: 300 KQVGNYQEVFDRNVGKDSALKIARGQNALWNQGGIQYAPPVR 341 Lambda K H 0.315 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 341 Length adjustment: 29 Effective length of query: 314 Effective length of database: 312 Effective search space: 97968 Effective search space used: 97968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory