Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate WP_084934354.1 HA51_RS09875 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >NCBI__GCF_002095475.1:WP_084934354.1 Length = 251 Score = 125 bits (315), Expect = 9e-34 Identities = 66/201 (32%), Positives = 122/201 (60%), Gaps = 4/201 (1%) Query: 156 GGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSV 215 GG++ TL+I+ + ++ A P+G++L L R S + ++ RG+PL+ V+F + Sbjct: 26 GGVLCTLLISVLAVLLAFPIGVLLGLARLSPWRWLSWPATCWVYLLRGIPLMMVVFWTYF 85 Query: 216 MLPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSM 275 +PL + G N L +++++SAYIAE+VRGG+QA+P GQYEA+ A+G+ + +++ Sbjct: 86 CVPLLI--GHNISGFATMLCTLVIYESAYIAEIVRGGIQALPHGQYEASRALGMSHLKTL 143 Query: 276 GLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYV 335 LVILPQAL +P +V+ +++ KD++L +I + +L + Q + + L + + Sbjct: 144 RLVILPQALFNTLPSLVSQLVSIIKDSTLGYVINVPELTFAANQVS--NQLLTKPFQVFA 201 Query: 336 FAALVFWIFCFGMSRYSMHLE 356 AL +++ CF ++ + LE Sbjct: 202 IVALSYYLICFSLTWLANKLE 222 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 251 Length adjustment: 27 Effective length of query: 338 Effective length of database: 224 Effective search space: 75712 Effective search space used: 75712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory