Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate WP_084938027.1 HA51_RS24870 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >NCBI__GCF_002095475.1:WP_084938027.1 Length = 366 Score = 499 bits (1284), Expect = e-146 Identities = 238/366 (65%), Positives = 290/366 (79%), Gaps = 6/366 (1%) Query: 1 MTTHTFKPDMPP-PGSSIGVV-AWMRANMFSSWINTLLTLFAFYLIYLIVPPLVQWAILD 58 +TTH + PP P + +G W R N+FSSW+NTLLTLF+F++I+ +PP + W + Sbjct: 3 VTTH----ETPPVPSNPLGKAWLWARKNLFSSWLNTLLTLFSFWIIWSFIPPALNWLVFQ 58 Query: 59 ANWVGTTRADCTKEGACWVFIQQRFGQFMYGYYPADLRWRVDLTVWLAVIGVAPLFISRF 118 ANW+G TRADCTK GACWVFI RFGQFMYG YP +LRWR++L + + ++ + P+FI Sbjct: 59 ANWIGETRADCTKAGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSLVPMFIKSM 118 Query: 119 PRKAIYGLSFLVLYPISAWCLLHGGVFGLDAVATSQWGGLMLTLVIATVGIVGALPLGIV 178 PR+ Y ++V+YPI W LL+GG GL+ V T QWGGL LTL+IA+VGI GALPLGI+ Sbjct: 119 PRRGRYIACWVVVYPIVVWLLLYGGYLGLERVETRQWGGLTLTLIIASVGIAGALPLGIL 178 Query: 179 LALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALIGVI 238 LAL RRS MP +R + V FIEFWRGVPLITVLFMSSVMLPLF+ EG DKL+RAL+GVI Sbjct: 179 LALARRSKMPVVRTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVI 238 Query: 239 LFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFIAL 298 LFQSAY+AEVVRGGLQA+PKGQ EAA ++ LGYW++ LVILPQALKL IPG+VNT IAL Sbjct: 239 LFQSAYVAEVVRGGLQALPKGQTEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIAL 298 Query: 299 FKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVFAALVFWIFCFGMSRYSMHLERK 358 FKDTSLVIIIGLFDL +SV+QA DP WLGM+TEGYVFAA+V+WIFCF MSRYS +LE++ Sbjct: 299 FKDTSLVIIIGLFDLFSSVQQATVDPTWLGMSTEGYVFAAMVYWIFCFSMSRYSQYLEKR 358 Query: 359 LDTGHK 364 TG K Sbjct: 359 FHTGLK 364 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 681 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 366 Length adjustment: 30 Effective length of query: 335 Effective length of database: 336 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory