Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_084933739.1 HA51_RS07065 urea ABC transporter ATP-binding protein UrtD
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_002095475.1:WP_084933739.1 Length = 263 Score = 164 bits (415), Expect = 2e-45 Identities = 90/247 (36%), Positives = 150/247 (60%), Gaps = 7/247 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L+++ + F G +AL+D++L + + +IGPNGAGK+TL++ + GK PD G V++ Sbjct: 22 VLQLEKINVSFDGFRALTDLSLKIGVGELRCVIGPNGAGKTTLMDVITGKTRPDNGQVIY 81 Query: 63 DGKSVLGR-APYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSG 121 D + L R +P EI + GI R FQ P +F L+V EN+ I K D + + + ++G Sbjct: 82 DQDTDLTRMSPVEIARAGIGRKFQKPTVFEALTVSENLEIA--LKNDKSVWASLRARLNG 139 Query: 122 QRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMAR 181 ++ ++ + +L+ + + +R A +S G K+ LEIGM L Q+P LLLLDEP AGM Sbjct: 140 EQQ--DRIDEVLKLLRLGGERQRKAGLLSHGQKQFLEIGMLLVQDPHLLLLDEPAAGMTD 197 Query: 182 ADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPK 241 A+T T +L + + + ++ ++EHDM V ++AD +TVL QG L E + ++ + + Sbjct: 198 AETEYTAELFRSLAGKH--SLMVVEHDMGFVETIADHVTVLHQGQVLAEGSLRQVQADDR 255 Query: 242 VREAYLG 248 V + YLG Sbjct: 256 VIDVYLG 262 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 263 Length adjustment: 24 Effective length of query: 227 Effective length of database: 239 Effective search space: 54253 Effective search space used: 54253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory