Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate WP_084936077.1 HA51_RS18580 glutamate/aspartate:proton symporter GltP
Query= TCDB::Q848I3 (444 letters) >NCBI__GCF_002095475.1:WP_084936077.1 Length = 433 Score = 316 bits (809), Expect = 1e-90 Identities = 169/419 (40%), Positives = 264/419 (63%), Gaps = 17/419 (4%) Query: 10 SLYFQVIVAIAIGILLG---HFYPQTGV-----ALKPLGDGFIKLIKMVIAPIIFCTVVS 61 +L +Q+++A+ +GI++G H P L P GD FI LIKM++ PI+ +++ Sbjct: 7 TLAWQILIALILGIVVGTVLHNQPDDREWLITNLLTPAGDIFIHLIKMIVVPIVISSLIV 66 Query: 62 GIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTL---DASK 118 GIAG+ + K +G+ G ++YFE+++TIA+++G+ + NV QPG+G ID+STL D SK Sbjct: 67 GIAGVGDAKKLGRIGVKTIVYFEVITTIAIVVGITLANVFQPGSG--IDMSTLVTVDISK 124 Query: 119 VAAYVTA--GKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGA-YGKP 175 A A G +V IL++IP I + GD+L ++ FSV+FG L L + + P Sbjct: 125 YEATTQAVQGAPHGLVTTILSLIPQNIFASLVKGDMLPIIFFSVLFGMGLSALPSEHRDP 184 Query: 176 VLDFIDRFAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLF 235 ++ + MF + +MIM+ AP+G +A TI +G SL L +L++ Y+ + F Sbjct: 185 LVTVFRSISETMFKVTHMIMRYAPVGVFALIAVTIANFGFASLYPLAKLVLLVYVAILFF 244 Query: 236 VLVVLGAICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLV 295 VVLGA+ R + L+ +++EL++ TSSSE+ LPR++ KME GA K++ V Sbjct: 245 AFVVLGAVARFCKLRITTLMLILKDELILAYSTSSSETVLPRIMQKMEAYGAPKAITSFV 304 Query: 296 IPTGYSFNLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIV 355 +PTGYSFNLDG+++Y ++AA+FIAQ + +T +I L+L L+++SKG AGV G F+V Sbjct: 305 VPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSLTDEIILVLTLMVTSKGIAGVPGVSFVV 364 Query: 356 LAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQA 414 L ATL +VG +P+ GLA I G+DR M AR N++GNA+A +V+A+W + D Q +A Sbjct: 365 LLATLGSVG-IPLEGLAFIAGVDRIMDMARTALNVIGNALAVLVIARWENQFDVKQAEA 422 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 433 Length adjustment: 32 Effective length of query: 412 Effective length of database: 401 Effective search space: 165212 Effective search space used: 165212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory