Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_084933742.1 HA51_RS07075 urea ABC transporter permease subunit UrtB
Query= TCDB::P74318 (286 letters) >NCBI__GCF_002095475.1:WP_084933742.1 Length = 521 Score = 122 bits (305), Expect = 2e-32 Identities = 84/292 (28%), Positives = 140/292 (47%), Gaps = 13/292 (4%) Query: 2 DLSQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINL-- 59 DL F G+++GSI+ L A+GL +TYG+L + N AHG+ + L AY TW+ Sbjct: 224 DLFGQAFTGLSLGSILLLAALGLAITYGLLGVINMAHGEMLMLGAYATWFVQNLFQQFAP 283 Query: 60 ----WLSMALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWG 115 W + V ++ IG L +R ++ + G++L L + +++G Sbjct: 284 QWLAWYPLLALPVAFLVTAGIGMLLERTIIRHLYGRPLETLLATWGISLMLIQLVRMLFG 343 Query: 116 GNNQNYRVPIVPA---QDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVAD 172 N P + Q + Y R+ VI A + + L+L +T++G ++RAV Sbjct: 344 AQNLEVANPSWLSGGWQVLPNLVLPYNRIAVILFVFAVLGLTWLLLNKTRLGLSVRAVTQ 403 Query: 173 NVDLAKVSGINVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGG 232 N +A G+ + M + + + + LGG + + P +G I+ F V+LGG Sbjct: 404 NRAMADCCGVPTGRIDMLAFGLGSGIAGLGGVALSQLGNVGPELGQGYIIDSFLVVVLGG 463 Query: 233 IGNPYGAIAGGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFI--RPQGLF 282 +G G + +G+ +V P G +G L+L++IILFI RPQGLF Sbjct: 464 VGQLAGTVVAAFGLGILNKVLEPQIGA--VLGKILILVLIILFIQKRPQGLF 513 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 521 Length adjustment: 30 Effective length of query: 256 Effective length of database: 491 Effective search space: 125696 Effective search space used: 125696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory