Align L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized)
to candidate WP_084935592.1 HA51_RS15895 sugar ABC transporter ATP-binding protein
Query= CharProtDB::CH_014279 (504 letters) >NCBI__GCF_002095475.1:WP_084935592.1 Length = 501 Score = 402 bits (1034), Expect = e-116 Identities = 220/493 (44%), Positives = 317/493 (64%), Gaps = 3/493 (0%) Query: 4 STPYLSFRGIGKTFPGVKALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGS 63 +TP L R I + F AL + + G+VHALMGENGAGKSTL+KIL+G Y ++G Sbjct: 3 ATPILEMREITRRFGSFYALKGVDLTVWPGEVHALMGENGAGKSTLMKILAGAYTASSGE 62 Query: 64 VVINGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYE 123 ++I+GQ + AL AG+ +IYQE++L P +TVAENI+LG +GG+V R + E Sbjct: 63 ILIDGQPYAIKGPKEALAAGITLIYQEINLAPNLTVAENIFLGSEITRGGLVKRRQMAEE 122 Query: 124 AGLQLKHLGMDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIDNLF 183 A L + LG + LSI + Q VEIA+AL RN++I+ DEPT++LS RE + LF Sbjct: 123 AQLVINRLGAQFSATDLVSRLSIAEQQQVEIARALHRNSRILVMDEPTAALSNRETEQLF 182 Query: 184 RVIRELRKEGRVILYVSHRMEEIFALSDAITVFKDGRYVKTFTDMQQVDHDALVQAMVGR 243 +I+ LR EG I+Y+SHRM E++ LSD ++V +DG+YV + T Q++ LV+ MVGR Sbjct: 183 ALIKRLRSEGMAIIYISHRMAEVYELSDRVSVLRDGQYVGSLT-RDQLNASELVRMMVGR 241 Query: 244 DIGDIYGWQPR-SYGEERLRLDAVKAPGVRTPISLAVRSGEIVGLFGLVGAGRSELMKGM 302 + D++ +GE RL ++ + P SLAVR+GEIVGL GLVGAGRSEL + + Sbjct: 242 PLSDLFNKDRNIPFGEIRLAVNHLTDNRKVHPSSLAVRAGEIVGLAGLVGAGRSELAQLI 301 Query: 303 FGGTQITAGQVYIDQQPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRDNINISARRK 362 FG Q G+++ID + + I P AIA G+ E+RK +G+ + ++NI ++ + Sbjct: 302 FGVHQPKGGEIWIDGEKVKIHSPRDAIARGIGFLTENRKEQGLFLELAAQENIVMATIER 361 Query: 363 HVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKVIL 422 G ++N + A I SLNI+ P A+ LSGGNQQK ++ RW+S +++L Sbjct: 362 DASYG-LLNRRKGQKIASEAIESLNIRVPHAQVRAGGLSGGNQQKLLISRWVSIAPRILL 420 Query: 423 LDEPTRGIDVGAKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMREGEIAGELL 482 LDEPTRG+DVGAK EIY ++ +A QGVA+L SS+LPEV+G++DR+ VMREG IAGEL Sbjct: 421 LDEPTRGVDVGAKSEIYRMMNQMAQQGVAILMISSELPEVVGMSDRVYVMREGSIAGELS 480 Query: 483 HEQADERQALSLA 495 ++ + ++LA Sbjct: 481 GKEISQENIMTLA 493 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 646 Number of extensions: 25 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 504 Length of database: 501 Length adjustment: 34 Effective length of query: 470 Effective length of database: 467 Effective search space: 219490 Effective search space used: 219490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory