Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized)
to candidate WP_084938027.1 HA51_RS24870 amino acid ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4772 (223 letters) >NCBI__GCF_002095475.1:WP_084938027.1 Length = 366 Score = 137 bits (346), Expect = 2e-37 Identities = 75/209 (35%), Positives = 125/209 (59%), Gaps = 7/209 (3%) Query: 16 WNGMIMTLKLMAMGVIGGIILGTILALMRLSHNKVLSNIAGAYVNYFRSIPLLLVITWFY 75 W G+ +TL + ++G+ G + LG +LAL R S V+ ++ ++ ++R +PL+ V+ Sbjct: 155 WGGLTLTLIIASVGIAGALPLGILLALARRSKMPVVRTLSVIFIEFWRGVPLITVLFMSS 214 Query: 76 LAVPFVLRWITGEDTPIGAFASCIVAFMMFEAAYFCEIVRAGVQSIPKGQMGAAQALGMS 135 + +P + E T I +V ++F++AY E+VR G+Q++PKGQ AA++L + Sbjct: 215 VMLPLFM----AEGTTIDKLVRALVGVILFQSAYVAEVVRGGLQALPKGQTEAAESLALG 270 Query: 136 YGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYAVGLVD-FLNASRASGD--IIGRS 192 Y + L+ILPQA + P L+ I LF+DTSLV +GL D F + +A+ D +G S Sbjct: 271 YWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLGMS 330 Query: 193 NEFLIFAGLVYFIISFAASQLVKRLQKRF 221 E +FA +VY+I F+ S+ + L+KRF Sbjct: 331 TEGYVFAAMVYWIFCFSMSRYSQYLEKRF 359 Lambda K H 0.332 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 366 Length adjustment: 26 Effective length of query: 197 Effective length of database: 340 Effective search space: 66980 Effective search space used: 66980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory