Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_084934011.1 HA51_RS07990 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_002095475.1:WP_084934011.1 Length = 214 Score = 151 bits (382), Expect = 9e-42 Identities = 71/198 (35%), Positives = 122/198 (61%) Query: 45 INGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLF 104 + G TL +SI A++ +T+ G + V+ TSR + + IY ELF+ P++I + F++ Sbjct: 13 LKGLGITLLLSIAAIIGSTLLGLLAAVLRTSRLPVAKQIAVIYTELFRGTPVLITLMFIY 72 Query: 105 YALPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQGFTYIQQMRY 164 + + G +++F G+LG+ Y GAY++EV R+GI AVP+GQ+E S G + Q Sbjct: 73 FGVAYFGYEINLFAAGILGLSIYQGAYIAEVFRAGIEAVPKGQWEVSWILGLSKRQTFMS 132 Query: 165 IIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYAPAYIFAAVL 224 +++PQT I+LPP+ Q ++LIK+TS++ ++G +ELMH + G Y A+L Sbjct: 133 VVLPQTRGIVLPPLAGQYLSLIKDTSIVSMIGMSELMHQGQAIVDRIGQPVVIYGLVALL 192 Query: 225 YFIICYPLAYFAKAYENK 242 YF IC+PL+ + + ++ + Sbjct: 193 YFAICFPLSRWVQHHQTR 210 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 214 Length adjustment: 23 Effective length of query: 227 Effective length of database: 191 Effective search space: 43357 Effective search space used: 43357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory