Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_084933101.1 HA51_RS05940 dipeptide ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_002095475.1:WP_084933101.1 Length = 328 Score = 198 bits (504), Expect = 1e-55 Identities = 108/314 (34%), Positives = 187/314 (59%), Gaps = 4/314 (1%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 +L V L+V + + + +AV+ +S+ VE+G+++GI+GESGSGK+ AI+ I PG Sbjct: 3 LLNVEKLSVHFGDEKTPF-RAVDRISYQVEQGQVVGIVGESGSGKSVSSLAIMGLIDYPG 61 Query: 105 KIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGE 164 ++++ K+ FN D+ ++ E R+L+ +++ + Q +LNP + H Sbjct: 62 RVMAEKLEFNQRDLQKISEKERRQLVGAEVAMIFQDPMTSLNPCYTVGFQIMEALKVHQG 121 Query: 165 ADKKRVIERASELLKLVGL-DPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPT 223 K +RA +LL VG+ DPA L +YP QLSGGM QRVMIA+++ PKL++ DEPT Sbjct: 122 GSKSTRRQRAIDLLDQVGIPDPASRLDVYPHQLSGGMSQRVMIAMAIACKPKLLIADEPT 181 Query: 224 SALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEI 283 +ALD+ Q +++L+ ++ ++ + ++ +THD+ +A+ A ++VMY G V+E GK +I Sbjct: 182 TALDVTIQAQIIELLLDLQKQENMALILITHDLALVAEAAQHIIVMYAGQVVETGKAVDI 241 Query: 284 IKSPLNPYTSLLVSSIPSLKGE-VKVINVPLDEP-LVSKEKGCPFLARCSKAFGRCKEEL 341 K+P +PYT ++ ++P + ++ ++P P + GC RC RC+ E Sbjct: 242 FKAPRHPYTQAMLRALPEFAADKARLASLPGVVPGKYDRPTGCLLNPRCPYVTERCRREE 301 Query: 342 PEIRLVYDRKVRCH 355 PE+R + R+ +CH Sbjct: 302 PELRDIPGRQSKCH 315 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 328 Length adjustment: 29 Effective length of query: 333 Effective length of database: 299 Effective search space: 99567 Effective search space used: 99567 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory