Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_084935308.1 HA51_RS14510 3-oxoacyl-ACP reductase FabG
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_002095475.1:WP_084935308.1 Length = 244 Score = 126 bits (316), Expect = 5e-34 Identities = 85/255 (33%), Positives = 132/255 (51%), Gaps = 15/255 (5%) Query: 7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVT 66 S +G VA++TG + G+G A AE LV +GA V SG EA + LG+N +VT Sbjct: 2 SFEGKVALVTGASRGIGRAIAETLVARGAKVVGTATSESGAEAISAYLGDNGKGLLLNVT 61 Query: 67 SEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTF 126 +++ L + +FG VD+ VN AGI + +K +++ +LD NL F Sbjct: 62 DAASIESVLEKVRAEFGEVDILVNNAGITRDNLLMRMKD------DEWADILDTNLTSVF 115 Query: 127 NVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDL 186 + + V M + + G II SV G GQA Y+A+K G++G + +AR++ Sbjct: 116 RLSKAVLRAMMKK------RVGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREI 169 Query: 187 APIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQ--AIIENP 244 A GI V +APG T + +L E + + ++VP RLGDP E A+ V A E Sbjct: 170 ASRGITVNVVAPGFIETDMTRALNEDQRSGILAEVP-AGRLGDPQEIANAVAFLASDEAS 228 Query: 245 FLNGEVIRLDGAIRM 259 ++ GE + ++G + M Sbjct: 229 YITGETLHVNGGMYM 243 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 244 Length adjustment: 24 Effective length of query: 237 Effective length of database: 220 Effective search space: 52140 Effective search space used: 52140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory