Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate WP_084931296.1 HA51_RS00995 sugar porter family MFS transporter
Query= SwissProt::P96710 (464 letters) >NCBI__GCF_002095475.1:WP_084931296.1 Length = 483 Score = 295 bits (754), Expect = 3e-84 Identities = 169/470 (35%), Positives = 257/470 (54%), Gaps = 20/470 (4%) Query: 3 NTPTQLEPNVPVTRSHSMGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFME 62 +T T PN VTR+ FV +I+ A LGGLL+GYDT V+SGA+ F++D L+PF Sbjct: 8 STNTASGPN-SVTRTEP--FVKIIALVATLGGLLFGYDTGVVSGALLFMRDDLQLTPFTT 64 Query: 63 GLVISSIMIGGVVGVGISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARII 122 GLV SS++ G G ++G +D GRRKI++ A +FA+ A+ SA + DV ++I++R+ Sbjct: 65 GLVTSSLLFGAAFGALLAGHFADAMGRRKIIIMLAFIFALGAVGSAFAPDVVSMIVSRLF 124 Query: 123 GGLGIGMGSSLSVTYITEAAPPAIRGSLSSLYQLFTILGISATYFINLAVQRSGTYEWGV 182 G+ +G ++ YI E AP RG L +L +L + G Y N WG Sbjct: 125 LGIAVGGAAATVPVYIAEIAPANKRGQLVTLQELMIVSGQLLAYVSNATFNEI----WGG 180 Query: 183 HTGWRWMLAYGMVPSVIFFLVLLVVPESPRWLAKAGKTNEALKILTRINGETVAKEELKN 242 WRWMLA VP+V+ +L ++ +PESPRW G T EA K+L + + EL+ Sbjct: 181 EHTWRWMLAISTVPAVLLWLGMIFMPESPRWHVMRGNTGEARKVLEKTRAADDVEWELEE 240 Query: 243 IENSLKIEQM---GSLSQLFKPGLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFG 299 IE +++ + G L L P LRK ++GI +A Q+ G+N I YY P + G Sbjct: 241 IEETIEENRQKGKGRLRDLKTPWLRKVFLLGIGIAAIQQLTGVNTIMYYAPTMLTATGLS 300 Query: 300 QNAGFVTTCIVGVVEVIFTVIAVLLIDKVGRKKLMSIGSAFMAIFMILIGTSFYF----- 354 +A T GV+ V+ T++ + +I K+GR+ L+ +G + I +F Sbjct: 301 NDAALFATIANGVISVLMTLVGIWMIGKIGRRPLVLVGQMGCTACLFFIAAVCFFMPEYH 360 Query: 355 -----ELTSGIMMIVLILGFVAAFCVSVGPITWIMISEIFPNHLRARAAGIATIFLWGAN 409 L +++ +L F+ ++ P+TW+++SEIFP LR G A LW AN Sbjct: 361 VGGEVNLVRAYLVLTGMLMFLCFQQGALSPVTWLLLSEIFPARLRGICMGGAVFALWMAN 420 Query: 410 WAIGQFVPMMIDSFGLAYTFWIFAVINILCFLFVVTICPETKNKSLEEIE 459 +AI P+++ +FGLA F FA+I I +FV+ PET+ +SLE+IE Sbjct: 421 FAISMAFPILLAAFGLAGAFLAFAIIGIGGSMFVLRTIPETRGRSLEQIE 470 Lambda K H 0.327 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 483 Length adjustment: 33 Effective length of query: 431 Effective length of database: 450 Effective search space: 193950 Effective search space used: 193950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory