Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_084934374.1 HA51_RS09990 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_002095475.1:WP_084934374.1 Length = 363 Score = 310 bits (795), Expect = 3e-89 Identities = 169/321 (52%), Positives = 221/321 (68%), Gaps = 4/321 (1%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 M L L V+K+Y V V+ I+L I GE +VFVGPSGCGKSTLLRMIAGLE+I+ G L Sbjct: 1 MTSLHLQSVKKSYDHVNVIHGIDLTINSGEFVVFVGPSGCGKSTLLRMIAGLEEISDGKL 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 I+G + P +RGIAMVFQSYALYP+MTVR N+++ L++ KKS+AEI+ A+ A + Sbjct: 61 LIEGADMTHQPATERGIAMVFQSYALYPNMTVRGNLAYPLEVMKKSKAEIEQAINQTAAR 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 L L + LDRLP+ALSGGQRQRVAIGR+I+R P+++LFDEPLSNLDA LR+ R+EIA+L Sbjct: 121 LHLTELLDRLPRALSGGQRQRVAIGRAIIRHPRIFLFDEPLSNLDAELRLQMRIEIARLH 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 ++ +TM+YVTHDQ+EAMTLA RIVVL G I QVG+P+ LY P+N FVA FIGSPKM Sbjct: 181 SSL-GNTMIYVTHDQLEAMTLADRIVVLRQGKIEQVGAPMTLYHDPDNLFVAGFIGSPKM 239 Query: 241 NLLPGKI--IGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYV 298 N LP ++ + GA G + + G V +GVRPE + A+ + + Sbjct: 240 NFLPAEVAAVTPGAVQLRVPALGIHNLKMNINAACREGQKVTLGVRPEHFIPASSDAEAL 299 Query: 299 -FEGKVAITEALGEVTLLYFE 318 F ++ +E LG LY + Sbjct: 300 SFSADLSFSEMLGHTNYLYLD 320 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 363 Length adjustment: 30 Effective length of query: 343 Effective length of database: 333 Effective search space: 114219 Effective search space used: 114219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory