Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_084934354.1 HA51_RS09875 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_002095475.1:WP_084934354.1 Length = 251 Score = 118 bits (295), Expect = 2e-31 Identities = 64/209 (30%), Positives = 118/209 (56%), Gaps = 12/209 (5%) Query: 173 GGLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASV 232 GG++ TL++S + + ++ P+G+LL L R S + ++ ++RG+PL+ V+F Sbjct: 26 GGVLCTLLISVLAVLLAFPIGVLLGLARLSPWRWLSWPATCWVYLLRGIPLMMVVFWTYF 85 Query: 233 MLPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKT 292 +PL + G N+ L + I+ SAY+AE++RGG+QA+P GQ+E + +LG+ + + Sbjct: 86 CVPLLI--GHNISGFATMLCTLVIYESAYIAEIVRGGIQALPHGQYEASRALGMSHLKTL 143 Query: 293 RLIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWAS---AVTP 349 RL+I+PQA+ +PS+V+ + KD++L +I + +L F+ AN S P Sbjct: 144 RLVILPQALFNTLPSLVSQLVSIIKDSTLGYVI------NVPELTFA-ANQVSNQLLTKP 196 Query: 350 ITGLIFAGFIFWLFCFGMSRYSGFMERHL 378 ++L CF ++ + +E H+ Sbjct: 197 FQVFAIVALSYYLICFSLTWLANKLEAHI 225 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 251 Length adjustment: 27 Effective length of query: 357 Effective length of database: 224 Effective search space: 79968 Effective search space used: 79968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory