Align Probable enoyl-CoA hydratase echA12; EC 4.2.1.17 (uncharacterized)
to candidate WP_084932602.1 HA51_RS05000 enoyl-CoA hydratase/isomerase family protein
Query= curated2:Q7U004 (285 letters) >NCBI__GCF_002095475.1:WP_084932602.1 Length = 247 Score = 87.4 bits (215), Expect = 3e-22 Identities = 65/215 (30%), Positives = 95/215 (44%), Gaps = 9/215 (4%) Query: 20 VLVEHPRPEIAQITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSSG 79 +L+ R I ++T+NRPER N++ + M L AL D+ VRV+VLT A F +G Sbjct: 1 MLIVETRDGICRLTMNRPERRNALGSESMALLLAALQAADIDSEVRVIVLTAAAPAFCAG 60 Query: 80 ADHKSAGVVPHVENLTRPTYALRSMELLDDVILMLRRLHQPVIAAVNGPAIGGGLCLALA 139 +D K G + P R V+ + +P+IAAV G A+GGG LA A Sbjct: 61 SDLKELGGL-------SPEEMCRHEAATAAVVRYFAAMDKPIIAAVEGYALGGGFALAAA 113 Query: 140 ADIRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIG 199 D+ V S S + ++NG GL L+ R G RA + ++ E+A IG Sbjct: 114 CDVVVTSVSTRWHMPEVSNG-WLPPWGLKALIART-GPHRARSLCWGLEALNGEQAVSIG 171 Query: 200 LVSRQVPDEQLLDACYAIAARMAGFSRPGIELTKR 234 L D +A + + KR Sbjct: 172 LADVMCDPGHAEDTALTLAHKFVALPAESVTSCKR 206 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 247 Length adjustment: 25 Effective length of query: 260 Effective length of database: 222 Effective search space: 57720 Effective search space used: 57720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory