Align S-adenosylmethionine permease SAM3 (characterized)
to candidate WP_084936204.1 HA51_RS19300 L-asparagine permease
Query= CharProtDB::CH_091257 (587 letters) >NCBI__GCF_002095475.1:WP_084936204.1 Length = 496 Score = 188 bits (478), Expect = 4e-52 Identities = 118/406 (29%), Positives = 203/406 (50%), Gaps = 16/406 (3%) Query: 73 YQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLASGPAALLIGFLLVGTSMFCVVQSAAELS 132 YQK + R + MIAIGG +GTGLF+G G L AL + +L+ G F ++++ EL Sbjct: 26 YQKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLVCGIFSFFILRALGELV 85 Query: 133 CQFPVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVW 192 P SGS+ ++ F+ E + Y + W ++ ++ AL + YW + W Sbjct: 86 LHRPSSGSFVSYAREFLGEKASYVAGWMYFVNWAMTGIVDITAVALYMHYWGAFGDVPQW 145 Query: 193 VAIFYVFIMV--LNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGA 250 V +V +N+ GV+ FAE EF ++IKV+AI +F+I+G+V + G P G Sbjct: 146 VFALGALAIVGTMNMIGVKWFAEMEFWFALIKVLAIAVFLIVGVVFLGSGKPLDGNTTGF 205 Query: 251 KYWHDPGAFAKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKN-ISAISRAAKGTFWRIA 309 D G F+F ELV + E K+ + + +A WRI Sbjct: 206 HLITDNGGLFPHGLLPALVLVQGVVFAFASIELVGTAAGECKDPKTMLPKAINSVIWRIG 265 Query: 310 IFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVA 369 +FY+ +VV++ L+P+ N+ SPFV S G + + MN+V+L A Sbjct: 266 LFYVGSVVLLVLLLPW---------NAYQAGQSPFVTFFSKLGV--PYIGSVMNIVVLSA 314 Query: 370 VVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKE 429 +S NS +Y++ R+++++ G P S M ++ P GI ++ A ++G ++ Sbjct: 315 ALSSLNSGLYSTGRILRSMSMGGSAPQFMSKMSKQQVPYAGILVTIAVYVVGVVLNYYVP 374 Query: 430 DEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYK 475 +VF + + S+ +W I + Q+R R A+K +G++ D++++K Sbjct: 375 SQVFEIVLNVASLGIISSWAFIVVCQMRLRKAIK-EGKA-DDVSFK 418 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 587 Length of database: 496 Length adjustment: 35 Effective length of query: 552 Effective length of database: 461 Effective search space: 254472 Effective search space used: 254472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory