Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_084935209.1 HA51_RS14055 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_002095475.1:WP_084935209.1 Length = 494 Score = 171 bits (432), Expect = 4e-47 Identities = 89/254 (35%), Positives = 148/254 (58%), Gaps = 6/254 (2%) Query: 8 IRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFE 67 + +GI K F V AL VS+ + PG H L+G+NGAGKST +K + G+++P KG I + Sbjct: 6 LEAEGISKFFPGVKALDNVSLRIKPGSVHALMGENGAGKSTLMKCLIGMYRPDKGTIRIK 65 Query: 68 GQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRI 127 G+P+ F D DA+ +GI+ +HQ L ++P M+V+ N ++G EP++ DH N+ Sbjct: 66 GEPVQFQDTMDALRSGISMIHQELNLVPYMTVAENIWLGREPMK----YGFVDHGKLNKQ 121 Query: 128 TMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANV 187 T E + ++ I L+ D+ VG LS +Q V IA+AV + + ++I+DEPTSAL + A++ Sbjct: 122 TQELLNRLNIRLKA-DRMVGELSIAAQQMVEIAKAVSWNSDIVIMDEPTSALTETEVAHL 180 Query: 188 LATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAGG 247 I +R+QG A+++I+H + + D ++ G +G+ + + + L M G Sbjct: 181 FTIIRDLREQGKAIIYISHKMDEIFTITDEISIFRDGTWVGSNNTSEFTRQSLITQMV-G 239 Query: 248 QELATLEGSLGGTV 261 +EL L G + Sbjct: 240 RELTQLFPKFNGEI 253 Score = 97.1 bits (240), Expect = 7e-25 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 8/220 (3%) Query: 26 VSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIAAGIA 85 ++ V GE + G GAG+S ++++ G+ G++L +G P+ P AI G+A Sbjct: 272 INFTVRKGEILGVAGLVGAGRSEVMESLFGMESFDSGEVLIDGVPVKIDSPSTAIEKGMA 331 Query: 86 TV---HQHLAMIPLMSVSRNFFMGNEP--IRKIGPLKLFDHDYANRITMEEMRKMGINLR 140 + + + ++SV N + N P + K G H + ME++RK+ I Sbjct: 332 FLTEDRKKSGLFLVLSVMENMSIVNMPDYVSKAG---FVSHMKMAQDCMEQIRKLNIKTP 388 Query: 141 GPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQGVA 200 DQ + LSGG +Q V IAR + K+LILDEPT + V A + I ++ +GVA Sbjct: 389 TMDQIINNLSGGNQQKVLIARWLLAQPKILILDEPTRGIDVGAKAEIYRLISELANRGVA 448 Query: 201 VVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL 240 ++ ++ + L + DR V++ G+ G + + + E + Sbjct: 449 IIMVSSELPEILGMSDRVMVMHGGRITGILDKEEANQETI 488 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 494 Length adjustment: 29 Effective length of query: 232 Effective length of database: 465 Effective search space: 107880 Effective search space used: 107880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory