Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_084935592.1 HA51_RS15895 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_002095475.1:WP_084935592.1 Length = 501 Score = 177 bits (448), Expect = 5e-49 Identities = 94/245 (38%), Positives = 151/245 (61%), Gaps = 13/245 (5%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 P++ M+ I + FGS AL GV + V+PGE H L+G+NGAGKST +K ++G + + G+IL Sbjct: 5 PILEMREITRRFGSFYALKGVDLTVWPGEVHALMGENGAGKSTLMKILAGAYTASSGEIL 64 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYAN 125 +GQP P++A+AAGI ++Q + + P ++V+ N F+G+E I + G +K Sbjct: 65 IDGQPYAIKGPKEALAAGITLIYQEINLAPNLTVAENIFLGSE-ITRGGLVK-------- 115 Query: 126 RITMEEMRKMGINLRGPD----QAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGV 181 R M E ++ IN G V LS E+Q V IARA+H +++L++DEPT+AL Sbjct: 116 RRQMAEEAQLVINRLGAQFSATDLVSRLSIAEQQQVEIARALHRNSRILVMDEPTAALSN 175 Query: 182 RQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQ 241 R+T + A I ++R +G+A+++I+H + + DR +VL G+ +G+ R ++A EL Sbjct: 176 RETEQLFALIKRLRSEGMAIIYISHRMAEVYELSDRVSVLRDGQYVGSLTRDQLNASELV 235 Query: 242 DMMAG 246 MM G Sbjct: 236 RMMVG 240 Score = 100 bits (249), Expect = 6e-26 Identities = 64/225 (28%), Positives = 108/225 (48%), Gaps = 5/225 (2%) Query: 27 SVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIAAGIAT 86 S+ V GE L G GAG+S + + GVH+P G+I +G+ + PRDAIA GI Sbjct: 275 SLAVRAGEIVGLAGLVGAGRSELAQLIFGVHQPKGGEIWIDGEKVKIHSPRDAIARGIGF 334 Query: 87 VHQHLAMIPL---MSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGINLRGPD 143 + ++ L ++ N M I + L + +I E + + I + Sbjct: 335 LTENRKEQGLFLELAAQENIVMAT--IERDASYGLLNRRKGQKIASEAIESLNIRVPHAQ 392 Query: 144 QAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQGVAVVF 203 G LSGG +Q + I+R V ++L+LDEPT + V + + ++++ +QGVA++ Sbjct: 393 VRAGGLSGGNQQKLLISRWVSIAPRILLLDEPTRGVDVGAKSEIYRMMNQMAQQGVAILM 452 Query: 204 ITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAGGQ 248 I+ + + + DR V+ G G +IS E + + G Q Sbjct: 453 ISSELPEVVGMSDRVYVMREGSIAGELSGKEISQENIMTLATGAQ 497 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 501 Length adjustment: 29 Effective length of query: 232 Effective length of database: 472 Effective search space: 109504 Effective search space used: 109504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory