Align BadK (characterized)
to candidate WP_084934563.1 HA51_RS11045 fatty acid oxidation complex subunit alpha FadJ
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_002095475.1:WP_084934563.1 Length = 709 Score = 98.2 bits (243), Expect = 4e-25 Identities = 73/221 (33%), Positives = 116/221 (52%), Gaps = 15/221 (6%) Query: 14 VGIITLNRP-DVLNALNDALMDALGGALLAFDADDGI-GAIVIAGNTRAFAAGADIASMA 71 VG+IT++ P + +N L + + L ++ + G ++I+G + F AGADI SM Sbjct: 15 VGVITIDVPGEKMNTLRAEFVSQIKAVLAEARSNPQLAGLVLISGKSDNFVAGADI-SMI 73 Query: 72 AWSYSDVYGSNFITRNWETIRQIRK---PVLAAVAGLAYGGGCELALACDIVIAGRSAK- 127 A + + E + +I PV+AA+ G GGG ELALAC I K Sbjct: 74 AKCQTAEEAEALARQGQEVMAEIAALPFPVVAAIHGACLGGGLELALACSARICSLDEKT 133 Query: 128 -FALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRL 186 LPE++LGLLPG+GGTQRLP+ IG +A+ + LS + L A++A + G+V V Sbjct: 134 RLGLPEVQLGLLPGSGGTQRLPKLIGVPQALPLILSGKQLRAKQALKLGVVDDAV----- 188 Query: 187 RDETVALATTIAAFSAPALMALKESL-NRAFESTLAEGILF 226 ++ L T IA ++ + +L +R ++ + +LF Sbjct: 189 -PLSILLETAIAQVHKGKVLRRELTLRDRIMQAPMVRSLLF 228 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 709 Length adjustment: 32 Effective length of query: 226 Effective length of database: 677 Effective search space: 153002 Effective search space used: 153002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory