Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_139810667.1 HA51_RS10660 long-chain-fatty-acid--CoA ligase FadD
Query= BRENDA::A7KUK6 (562 letters) >NCBI__GCF_002095475.1:WP_139810667.1 Length = 558 Score = 201 bits (511), Expect = 6e-56 Identities = 166/554 (29%), Positives = 260/554 (46%), Gaps = 49/554 (8%) Query: 21 LFERKDRAYPDDKIIYQDADTQRHYTYKSLRDASLDFGKGLKALYEWRKGDVLALFTPNS 80 LFE Y D + + TY+ L S DF L+ ++GD +AL PN Sbjct: 28 LFEHAALQYADQTAF---VNMGQPMTYRELDKQSRDFAAWLQQGLGLKQGDRVALMMPNL 84 Query: 81 IDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQASVLPVAREAAKKVGM 140 + PV ++G L AG + NP YT EL QL +S A +V ++ + + + Sbjct: 85 LQYPVALFGVLRAGMVVVNVNPLYTPRELKHQLNDSGASAIVIVSNFAHTLEKVVAETPI 144 Query: 141 PEDRIILIGDQRDPDAR---------VKHFTSVRNISGATRYRKQKITPAK--------- 182 + +GDQ P VK ++ GA +R A+ Sbjct: 145 KHVMLTRMGDQLAPIKATLVNFVVKYVKKLVPKYHLPGAVPFRSALQQGAQMAYQRPTLT 204 Query: 183 --DVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWNGGPDGKGDRVLAFLP 240 D+AFL Y+ GTTGV KG M++H N+ AN+ Q G++L GK ++V+ LP Sbjct: 205 NDDLAFLQYTGGTTGVAKGAMLTHGNMQANLEQTKATYGKLLR-----AGK-EQVVTALP 258 Query: 241 FYHIYGLT--CLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSYIVPPVVLLLGKHP 298 YHI+ LT CL+ L G +L++ + DI + + + + V + L Sbjct: 259 LYHIFALTVNCLLFLDL-GGTNLLITNPRDIPGFVKELSKFPFTAITGVNTLFNALLNDA 317 Query: 299 VVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTTHSQRWEDWREA 358 +K D S+LR+ G + + + E + +GYGL+E SP + D Sbjct: 318 NFNKLDFSTLRLSAGGGMAVQKAVAERWEKLTGHYLLEGYGLTECSPLVSVNPY-DITCH 376 Query: 359 MGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHENPEATKGCLSE 418 GS+G +P+ + + E K+V GE GEL ++GP V +GY + PEAT+ L + Sbjct: 377 TGSIGLPVPSTDVRIVD-----DEDKDVPPGEPGELCIRGPQVMVGYWQRPEATEEVL-K 430 Query: 419 DGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAIDDVAVIGIES 478 +GW TGDV D +G I DR K++I GF V P E+E L+ + + + A IG+ S Sbjct: 431 NGWLHTGDVVTVDGEGFIRIVDRKKDMILVSGFNVYPNEIEDVLMQHPKVREAAAIGVPS 490 Query: 479 ETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLRGGVHFVDEIPKNP 538 + G V + C+V K +S T E+ ++ ++ +K + + F D++PK Sbjct: 491 DLSGEAVKV-CIV---KKDASLTKEE-----VLDHCRRQLTGYK-VPKIIEFRDDLPKTN 540 Query: 539 SGKILRRILKQKFK 552 GKILRR L+ + K Sbjct: 541 VGKILRRELRDEAK 554 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 679 Number of extensions: 35 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 562 Length of database: 558 Length adjustment: 36 Effective length of query: 526 Effective length of database: 522 Effective search space: 274572 Effective search space used: 274572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory