Align Dehydrocarnitine CoA-transferase and acetoacetate CoA-transferase, subunit A (characterized)
to candidate WP_084936299.1 HA51_RS19820 CoA transferase subunit A
Query= reanno::pseudo6_N2E2:Pf6N2E2_2111 (232 letters) >NCBI__GCF_002095475.1:WP_084936299.1 Length = 239 Score = 375 bits (963), Expect = e-109 Identities = 180/231 (77%), Positives = 210/231 (90%) Query: 1 MAGFDKRVSSYEEALEGLKDGMTVIAGGFGLCGIPENLIAEIKRKGIRDLTVVSNNCGVD 60 MAG DKRV+SY +AL GL+D MTV+AGGFGLCGIPENLIA+I+++G + L VVSNNCGVD Sbjct: 1 MAGLDKRVTSYPQALAGLEDNMTVLAGGFGLCGIPENLIAQIRQQGTKGLKVVSNNCGVD 60 Query: 61 GFGLGVLLEDRQIRKVVASYVGENALFEQQLLSGEIEVVLTPQGTLAEKMRAGGAGIPAF 120 GFGLG+LLE++QI+ ++ASYVGENALFEQQ+LSGE+EV+LTPQGTLAEK+RAGGAGIPAF Sbjct: 61 GFGLGLLLENQQIKTMIASYVGENALFEQQMLSGELEVILTPQGTLAEKVRAGGAGIPAF 120 Query: 121 FTATGVGTPVAEGKEVREFHGRQYLMEESITGDFAIVKGWKADHFGNVIYRHTAQNFNPL 180 +TATG GTPVAEGKEVR F GR Y++E++I GDFAIVKGWKAD +GNVIYRHTAQNFNPL Sbjct: 121 YTATGYGTPVAEGKEVRVFDGRHYILEQAIRGDFAIVKGWKADWYGNVIYRHTAQNFNPL 180 Query: 181 AATAGKITVVEVEEIVEPGELDPTQIHTPGIYVDRVICGTFEKRIEQRTVR 231 A A ++TVVEVEEIV PGELDP IHTPGIYVDR+I G+FEKRIEQRT+R Sbjct: 181 MAMAARVTVVEVEEIVAPGELDPAAIHTPGIYVDRLIQGSFEKRIEQRTLR 231 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 239 Length adjustment: 23 Effective length of query: 209 Effective length of database: 216 Effective search space: 45144 Effective search space used: 45144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory