Align 1-pyrroline-5-carboxylate dehydrogenase 2; P5C dehydrogenase 2; EC 1.2.1.88; L-glutamate gamma-semialdehyde dehydrogenase (uncharacterized)
to candidate WP_084934223.1 HA51_RS09135 aldehyde dehydrogenase
Query= curated2:Q9K5Z5 (515 letters) >NCBI__GCF_002095475.1:WP_084934223.1 Length = 478 Score = 261 bits (668), Expect = 3e-74 Identities = 166/474 (35%), Positives = 250/474 (52%), Gaps = 18/474 (3%) Query: 41 INGERVTT--DDKIVSVNPAMKEQVIGVVSKASREIVDDAFKSAETAFHTWKNVNPEERA 98 ING V D I +NPA E ++ + + ++ A +AE A W+ + ER Sbjct: 9 INGAFVADQHDKWIEVINPAT-EALLSRIPEGTKHDAAQAIAAAEAAQPGWEALPAIERG 67 Query: 99 NILIRAAAIIRRRKHEFSAWLVKEAGKPWKEADADTAEAIDFLEYYARQMITLKDGKPVN 158 N L + AA IR + E +A +V E GK A + D+LEY A + +G+ VN Sbjct: 68 NWLRKIAAGIRHHESELTATIVAEGGKTQGLAQTEVLFTADYLEYMA-EWARRYEGEIVN 126 Query: 159 S-REGEHNRYFYTPIGVCVTISPWNFALAIMAGTTVAPIVTGNTVLLKPASTTPVVAAKF 217 S R E+ F IGV I PWNF ++A +VTGNT+ +KP+ TP AA F Sbjct: 127 SDRPNENIFVFKKAIGVTTGILPWNFPFFLIARKAAPALVTGNTIAIKPSELTPNNAAIF 186 Query: 218 VEVLEEAGLPKGVVNFVPGSGTDIGDYLIDHPKTSLITFTGSRDVGVRLYERAAVVHPGQ 277 +++ E GLPKGV+NFV G G ++G L +P L++ TGS G+ + AA Sbjct: 187 AQIIHEIGLPKGVINFVYGYGPEVGQELAANPAVGLVSLTGSVGAGIATMQAAA------ 240 Query: 278 QHLKRVIVEMGGKDTVVVDKDADLDLAAQSIVTSAFGFSGQKCSAGSRAVIHQDVYDVVL 337 +++ +V +E+GGK +V DADLDLA ++IV+S +GQ C+ R + + +YD + Sbjct: 241 KNVTKVSLELGGKAPAIVMDDADLDLAVKAIVSSRVINTGQVCNCAERVYVQEGIYDRFI 300 Query: 338 EKAVALTKQLSVGEPT-APDVYMGPVVDQGAFSKIMSYI-EVGKEEGRLMVGGEGDDSKG 395 A KQ+ G P D+ MGP++ + A ++ + E G +++GG+ ++G Sbjct: 301 TALTAAMKQVKFGNPAEQTDIDMGPLITEAALGRVEKKVANAVAEGGTVVLGGKRVGNQG 360 Query: 396 FFIQPTIFADVDPHARIMQEEIFGPVVAFSKARDFDHALEIANNTEYGLTGAVITTNRHH 455 F+ +PTI V IMQEEIFGPV+ + D A+E+AN+ EYGLT ++ T N + Sbjct: 361 FYFEPTIITGVRQEMEIMQEEIFGPVLPVMAFKTLDEAIELANDCEYGLTSSIYTQNLNT 420 Query: 456 IEKAKRDFHVGNLYFNRNCTGAIVGYHPFGGFKMS---GTDSKAGGPDYLALHM 506 A R G Y NR A+ G+H G++ S G D + G +YL H+ Sbjct: 421 AMIALRKLKFGETYVNRENFEAMQGFH--AGWRKSGVGGADGRHGLEEYLQTHV 472 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 478 Length adjustment: 34 Effective length of query: 481 Effective length of database: 444 Effective search space: 213564 Effective search space used: 213564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory