Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate WP_084938278.1 HA51_RS25705 iron-containing alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >NCBI__GCF_002095475.1:WP_084938278.1 Length = 382 Score = 179 bits (455), Expect = 9e-50 Identities = 115/369 (31%), Positives = 186/369 (50%), Gaps = 3/369 (0%) Query: 12 LHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFDEVFPNP 71 + G A+ D+ L+ K+ KAL+VTD + + + SL + L + S + + V P P Sbjct: 8 ISGFQALNDLSYLLQGKE--KALLVTDKNIEGIPAVQSLIAQLKQQISSLSIVNSVPPEP 65 Query: 72 TEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGVGKVKNAGVP 131 ++ V AA S + D +I GGGS +D AK + IL + P+ G+ Sbjct: 66 SQHDVAAIVAALPSTDVDLVIGVGGGSVLDVAKLLSILCVDGAPTLDALLAGEKPQTRTT 125 Query: 132 LVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPASVTAATG 191 + I TTAGT +E T NA++ ++ K II P ++PD + +P + ++TG Sbjct: 126 SLLIPTTAGTGSEATPNAILAIPEKETKVGIITPVMLPDYVALVPELTTSMPPHIASSTG 185 Query: 192 MDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEAREQMAFGQYLAGM 251 +DAL H +E + + A+P++D AL ++ + L + + NLEAR M + Y G Sbjct: 186 IDALCHLIECFTATVANPVSDNYALIGMKKLFASLETTIAEPGNLEARLNMLWASYYGGA 245 Query: 252 AFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQAMGVETR 311 + AG LVHA+++ G ++LPHGV NAILL F RP AV++FA+ + Sbjct: 246 SIAHAGTHLVHAMSYPLGGKYHLPHGVANAILLAPCMRFVRPAAVSKFAQAYDLLPDADA 305 Query: 312 GMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADPCAPCN-PRTAS 370 + +EA S + L KR+ +P +LG+ + + ++ AL N P Sbjct: 306 TLDEEAKSHALVEYFAALVKRLKLPASLEELGIGPDHLPYLVEAALDVQRLMKNVPMKVG 365 Query: 371 RDEVRGLYL 379 D+VR +YL Sbjct: 366 ADDVRNVYL 374 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 382 Length adjustment: 30 Effective length of query: 352 Effective length of database: 352 Effective search space: 123904 Effective search space used: 123904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory