Align The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up (characterized)
to candidate WP_084936077.1 HA51_RS18580 glutamate/aspartate:proton symporter GltP
Query= TCDB::P96603 (421 letters) >NCBI__GCF_002095475.1:WP_084936077.1 Length = 433 Score = 360 bits (925), Expect = e-104 Identities = 184/426 (43%), Positives = 281/426 (65%), Gaps = 16/426 (3%) Query: 1 MKLFK-NLTVQVITAVIIGVIVGLVW---PD-----VGKEMKPLGDTFINAVKMVIAPII 51 MK FK L Q++ A+I+G++VG V PD + + P GD FI+ +KM++ PI+ Sbjct: 1 MKGFKLTLAWQILIALILGIVVGTVLHNQPDDREWLITNLLTPAGDIFIHLIKMIVVPIV 60 Query: 52 FFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKG 111 ++++GIA +GD KK+G++G K +YFEV+TT+A+++G+ + N+ +PG+G+D S L Sbjct: 61 ISSLIVGIAGVGDAKKLGRIGVKTIVYFEVITTIAIVVGITLANVFQPGSGIDMSTLVTV 120 Query: 112 DVSQY--TQNGGQGIDW--IEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAAL-GE 166 D+S+Y T QG + I ++P N+ + KGD+L ++FFS+LFG+GL+AL E Sbjct: 121 DISKYEATTQAVQGAPHGLVTTILSLIPQNIFASLVKGDMLPIIFFSVLFGMGLSALPSE 180 Query: 167 KGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYIT 226 ++ F +S FK+ IMR AP+G F +A TI +FG S+ PLA L++ VY+ Sbjct: 181 HRDPLVTVFRSISETMFKVTHMIMRYAPVGVFALIAVTIANFGFASLYPLAKLVLLVYVA 240 Query: 227 MFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSV 286 + F FV L + + + + +KDEL++ TSSSE+VLPR+M KME YG K++ Sbjct: 241 ILFFAFVVLGAVARFCKLRITTLMLILKDELILAYSTSSSETVLPRIMQKMEAYGAPKAI 300 Query: 287 VGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGS 346 V+PTGYSFNLDG+++Y S+A +F+AQ++G+DLS+ +I ++L LM+TSKG AGV G Sbjct: 301 TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSLTDEIILVLTLMVTSKGIAGVPGV 360 Query: 347 GFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAK 406 F+VL +TL ++ IPLEGLA + GVDR M R +N+IGN +A +++A+ EN+FD K Sbjct: 361 SFVVLLATLGSVG-IPLEGLAFIAGVDRIMDMARTALNVIGNALAVLVIARWENQFD-VK 418 Query: 407 SIEAVE 412 EA E Sbjct: 419 QAEAYE 424 Lambda K H 0.326 0.143 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 433 Length adjustment: 32 Effective length of query: 389 Effective length of database: 401 Effective search space: 155989 Effective search space used: 155989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory