Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_139810645.1 HA51_RS04965 enoyl-CoA hydratase/isomerase family protein
Query= reanno::psRCH2:GFF2391 (364 letters) >NCBI__GCF_002095475.1:WP_139810645.1 Length = 257 Score = 77.0 bits (188), Expect = 5e-19 Identities = 65/206 (31%), Positives = 97/206 (47%), Gaps = 26/206 (12%) Query: 19 LTLNRPAGLNAVTLEMVRLLQQQLSAWAADPQIHAVVLRANGEKAFCAGGDIRSLYDSFQ 78 + LNRP LNAVT M + + + P++ AV+L ANG KAFC G DI+ L D++Q Sbjct: 16 IALNRPEKLNAVTPAMSVSITKLAAFCNESPEVRAVILTANGPKAFCCGSDIKEL-DTYQ 74 Query: 79 RGDTEHETFFEEEYALDQYIHAYPKPLLALMDGFVLGGGMGLVQGASLRVVTERVRMGMP 138 H + A+ + KP + ++G+ LGGG+ L +RV T G P Sbjct: 75 -SPWAHRMKHDHCDAIAE----ITKPTICAINGYALGGGLELALCCDIRVSTRNALFGAP 129 Query: 139 EVGIGYFPDVGGSYFLSRLPGELGTYMGVTGLQIRAADALHVG-LADWCVSH--DQIAEL 195 E+ +G+ VGG G + Y+ T RA+ L+ G D H + EL Sbjct: 130 EIKLGW---VGG--------GGMAVYLNKTIGASRASRMLYTGDPVDSSTGHAWGIVDEL 178 Query: 196 DRCLDRMSWSVHPQEALRTLVATLGS 221 D M ++++TL AT+ S Sbjct: 179 FDTADDM------MDSVKTLAATIAS 198 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 257 Length adjustment: 27 Effective length of query: 337 Effective length of database: 230 Effective search space: 77510 Effective search space used: 77510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory