GapMind for catabolism of small carbon sources

 

Protein WP_085634733.1 in Marivita geojedonensis DPG-138

Annotation: NCBI__GCF_002115805.1:WP_085634733.1

Length: 508 amino acids

Source: GCF_002115805.1 in NCBI

Candidate for 27 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism kauB lo 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 39% 96% 350.1 L-sorbosone dehydrogenase subunit 49% 476.5
L-arginine catabolism puuC lo 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 39% 96% 350.1 L-sorbosone dehydrogenase subunit 49% 476.5
L-citrulline catabolism puuC lo 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 39% 96% 350.1 L-sorbosone dehydrogenase subunit 49% 476.5
putrescine catabolism puuC lo 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 39% 96% 350.1 L-sorbosone dehydrogenase subunit 49% 476.5
4-hydroxybenzoate catabolism praB lo 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized) 38% 99% 343.2 L-sorbosone dehydrogenase subunit 49% 476.5
L-tryptophan catabolism praB lo 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized) 38% 99% 343.2 L-sorbosone dehydrogenase subunit 49% 476.5
L-phenylalanine catabolism pad-dh lo aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized) 39% 93% 340.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-arginine catabolism patD lo aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized) 37% 99% 337.8 L-sorbosone dehydrogenase subunit 49% 476.5
L-citrulline catabolism patD lo aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized) 37% 99% 337.8 L-sorbosone dehydrogenase subunit 49% 476.5
putrescine catabolism patD lo aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized) 37% 99% 337.8 L-sorbosone dehydrogenase subunit 49% 476.5
L-arginine catabolism gabD lo Succinate-semialdehyde dehydrogenase, mitochondrial; At-SSADH1; Aldehyde dehydrogenase family 5 member F1; NAD(+)-dependent succinic semialdehyde dehydrogenase; Protein ENLARGED FIL EXPRESSING DOMAIN 1; EC 1.2.1.24 (characterized) 40% 88% 331.6 L-sorbosone dehydrogenase subunit 49% 476.5
L-citrulline catabolism gabD lo Succinate-semialdehyde dehydrogenase, mitochondrial; At-SSADH1; Aldehyde dehydrogenase family 5 member F1; NAD(+)-dependent succinic semialdehyde dehydrogenase; Protein ENLARGED FIL EXPRESSING DOMAIN 1; EC 1.2.1.24 (characterized) 40% 88% 331.6 L-sorbosone dehydrogenase subunit 49% 476.5
putrescine catabolism gabD lo Succinate-semialdehyde dehydrogenase, mitochondrial; At-SSADH1; Aldehyde dehydrogenase family 5 member F1; NAD(+)-dependent succinic semialdehyde dehydrogenase; Protein ENLARGED FIL EXPRESSING DOMAIN 1; EC 1.2.1.24 (characterized) 40% 88% 331.6 L-sorbosone dehydrogenase subunit 49% 476.5
L-tryptophan catabolism nbaE lo 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 (characterized) 37% 98% 318.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-arabinose catabolism xacF lo 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 37% 98% 283.9 L-sorbosone dehydrogenase subunit 49% 476.5
D-galacturonate catabolism dopDH lo 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 37% 98% 283.9 L-sorbosone dehydrogenase subunit 49% 476.5
D-glucuronate catabolism dopDH lo 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 37% 98% 283.9 L-sorbosone dehydrogenase subunit 49% 476.5
D-xylose catabolism dopDH lo 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 37% 98% 283.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-isoleucine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 34% 99% 261.9 L-sorbosone dehydrogenase subunit 49% 476.5
myo-inositol catabolism mmsA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 34% 99% 261.9 L-sorbosone dehydrogenase subunit 49% 476.5
propionate catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 34% 99% 261.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-threonine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 34% 99% 261.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-valine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 34% 99% 261.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-valine catabolism mmsA lo Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27) (characterized) 35% 93% 258.8 L-sorbosone dehydrogenase subunit 49% 476.5
L-lysine catabolism amaB lo Δ1-piperideine-6-carboxylate dehydrogenase (characterized) 36% 74% 204.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-arginine catabolism astD lo N-succinylglutamate 5-semialdehyde dehydrogenase; Succinylglutamic semialdehyde dehydrogenase; SGSD; EC 1.2.1.71 (characterized) 32% 94% 194.9 L-sorbosone dehydrogenase subunit 49% 476.5
L-citrulline catabolism astD lo N-succinylglutamate 5-semialdehyde dehydrogenase; Succinylglutamic semialdehyde dehydrogenase; SGSD; EC 1.2.1.71 (characterized) 32% 94% 194.9 L-sorbosone dehydrogenase subunit 49% 476.5

Sequence Analysis Tools

View WP_085634733.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNDLSINTSIAYELPQPFTGRHLIDGAWVTGRETFDRVSPSHGTVVSTSSKGGPEETDAA
IKAARRAFDAGIWSRISGRERAAVLLRVADLIEANVDRIALQETLESGKPISQSKGEVAG
AADLWRYAAALARTSQGDSHNTLGSDMLGVVVKDPIGVVSVITPWNFPFWILSQKLPFAL
AAGCTVVVKPSEMTPSSTVMMGELLMQAGLPAGVCNIVLGYGDPVGSLKSTHPDVDMVTF
TGSTAVGKLITKAASDTLKKVALELGGKNPQVIFPDADLENAADAVTFGVYFNVGQCCNS
SSRIIVHEDIAEDFVARVVALSKKVKFGDPLDPTTQVGAIVTPEHNARIDGYVQEAVAAG
ARLELGGAYLDVEGLGDQFYQPTVISSVSADMAVAREEVFGPVLSVLTFRTLDDAIALTN
DSEYGLSAGVWSESVHTCLEFARRAQAGTVWTNTWMDGYPELAFGGMKQSGTGREIGKYG
FEEFLEVKSVVMRVGRDSRAPWVTPRAE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory