Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_106299206.1 MGEO_RS14005 crotonobetainyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_002115805.1:WP_106299206.1 Length = 261 Score = 140 bits (352), Expect = 3e-38 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 13/255 (5%) Query: 12 GRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EKAFAAGADIGMM 70 G V V LNRPKA NA++ +G R F D + ++TG +K F G D+ Sbjct: 12 GHVLEVVLNRPKA-NAIDLQTSRAMGEVFRSFRDDPELRVAIITGGGDKFFCPGWDLKAA 70 Query: 71 STYTYMDVYKGDYITRNW---ETVRSIRKPIIAAVAGFALGGGCELAMMCDIIFAADTAK 127 + +D GDY + + +R + KP+IAAV G GGG ELA+ DII AAD A Sbjct: 71 ADGDAVD---GDYGVGGFGGLQELRDLNKPVIAAVNGICCGGGLELALSADIILAADHAS 127 Query: 128 FGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIPAASLV 187 F PEI+ G + A +LP+ + AM++ LT R++D EA R G V+ + PA +L+ Sbjct: 128 FALPEIRSGTVADAASV-KLPKRIPYHIAMEMLLTGRWLDVEEAARWGFVNHIHPADTLM 186 Query: 188 DEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVH--FERRL--FHSLFATEDQKEG 243 EA + AA +A P +KE V A +T + ++ +R+L L+A+EDQ+EG Sbjct: 187 TEARSMAALLASGPPLVYAAIKEIVREAEDTGFQDMMNRITKRQLATVDVLYASEDQQEG 246 Query: 244 MAAFVEKRKPVFKHR 258 AF EKR PV+K R Sbjct: 247 ARAFAEKRDPVWKGR 261 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory