Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate WP_085640555.1 MGEO_RS16995 ABC transporter permease subunit
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >NCBI__GCF_002115805.1:WP_085640555.1 Length = 404 Score = 306 bits (784), Expect = 7e-88 Identities = 173/383 (45%), Positives = 238/383 (62%), Gaps = 11/383 (2%) Query: 2 RAWVFQVVTVVAVIALGWFLFDNTQTNLQHRGITSGFGFLERSAGFGIAQHLIDYTEADS 61 R++ FQ + ++ +I +L N NL+ G+ + FL AG+ I Q LI YT + Sbjct: 24 RSYTFQFIALILLILAFGYLGSNLLANLKAAGLNISYQFLGEPAGYDINQTLIPYTSQST 83 Query: 62 YARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLLQ 121 + + L+G+LNTLLV F+G ++AT++G ++GV RLS NW++ +L ++YVE+FRN+P L+ Sbjct: 84 HWQASLVGVLNTLLVAFLGCLMATVIGVVVGVLRLSDNWLVRQLMSIYVEIFRNVPVLIW 143 Query: 122 ILFWYFAVFLS-MPGPR-------AAHNFGDTFFVSSRGLNMPAALVAEGFWPFVISVVL 173 IL AVF++ +P PR A F + RG PA + G FV++V L Sbjct: 144 ILI-IMAVFIAVLPQPRDFRGEDAEASMVLGMFAFTGRGFYTPAPIFGVGSG-FVVAVFL 201 Query: 174 AIVAIVLMTR-WANKRFEATGEPFHKFWVGLALFLVIPALSALLFGAPVHWEMPELKGFN 232 A +A + R +A K G FW +A+F + L+ + G P+ E PELKGFN Sbjct: 202 ASIAGIFAFRNYAKKALYERGRLIPTFWPSVAIFFIPSILAYFILGRPISLEYPELKGFN 261 Query: 233 FVGGWVLIPELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVI 292 F GG + L+AL AL++YTAAFIAE VR+GI +VS GQTEAA SLGLR G + V+ Sbjct: 262 FQGGIFMRNSLIALWFALSIYTAAFIAENVRAGILAVSKGQTEAAASLGLRPGRIMNLVV 321 Query: 293 IPQALRVIIPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVY 352 +PQALRVIIPPL SQYLNL KNSSLA +GY ++ G LNQTG+AIE I + M Y Sbjct: 322 LPQALRVIIPPLISQYLNLTKNSSLAIAVGYMDLTGTLGGITLNQTGRAIEAIFLLMLFY 381 Query: 353 LAISISISLLMNWYNKRIALIER 375 LAIS++IS +MN YN + L ER Sbjct: 382 LAISLAISAIMNVYNNAVKLKER 404 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 404 Length adjustment: 30 Effective length of query: 345 Effective length of database: 374 Effective search space: 129030 Effective search space used: 129030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory